Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.07
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 7.8e-05
breast carcinoma 1.300 6.8e-28
ductal carcinoma in situ 1.400 3.0e-04
glioblastoma -1.200 8.8e-05
intraductal papillary-mucinous neoplasm ... 1.400 3.5e-03
invasive ductal carcinoma 1.100 5.0e-03
medulloblastoma -1.200 3.7e-05
medulloblastoma, large-cell -2.000 6.0e-04
non-small cell lung cancer 1.842 5.5e-19
osteosarcoma -1.714 3.1e-03
ovarian cancer -1.100 2.2e-04

AA Sequence

MSDEASAITSYEKFLTPEEPFPLLGPPRGVGTCPSEEPGCLDISDFGCQLSSCHRTDPLHRFHTNRWNLT      1 - 70
SCGTSVASSEGSEELFSSVSVGDQDDCYSLLDDQDFTSFDLFPEGSVCSDVSSSISTYWDWSDSEFEWQL     71 - 140
PGSDIASGSDVLSDVIPSIPSSPCLLPKKKNKHRNLDELPWSAMTNDEQVEYIEYLSRKVSTEMGLREQL    141 - 210
DIIKIIDPSAQISPTDSEFIIELNCLTDEKLKQVRNYIKEHSPRQRPAREAWKRSNFSCASTSGVSGASA    211 - 280
SASSSSASMVSSASSSGSSVGNSASNSSANMSRAHSDSNLSASAAERIRDSKKRSKQRKLQQKAFRKRQL    281 - 350
KEQRQARKERLSGLFLNEEVLSLKVTEEDHEADVDVLM                                    351 - 388
//

Text Mined References (8)

PMID Year Title