Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
cystic fibrosis -1.085 4.5e-05
ependymoma 1.200 2.6e-03
glioblastoma multiforme 1.100 3.6e-06
group 3 medulloblastoma 2.000 1.3e-03
interstitial cystitis -1.600 4.1e-02
osteosarcoma -2.645 3.0e-07
ovarian cancer -1.300 3.8e-04

AA Sequence

MLRRGHLAFRDVAIEFPQEEWKCLDPAQRTLYREVMVENYRNLVFLGICLPDLSVISMLEQRRDPRNLQS      1 - 70
EVKIANNPGGRECIKGVNAESSSKLGSNAGNKSLKNQLGLTFQLHLSELQLFQAERNISGCKHVEKPINN     71 - 140
SLVSPLQKIYSSVKSHILNKYRNDFDDSPFLPQEQKAQIREKPCECNEHGKAFRVSSRLANNQVIHTADN    141 - 210
PYKCNECDKVFSNSSNLVQHQRIHTGEKPYKCHECGKLFNRISLLARHQRIHTGEKPYKCHECGKVFTQN    211 - 280
SHLANHHRIHTGEKPYKCNECGKVFNRNAHLARHQKIHSGEKPYKCKECGKAFSGGSGLTAHLVIHTGEK    281 - 350
LYKCNKCGKVFNRNAHLTRHQRIHTGEKPYECKECGKVFRHKFCLTNHHRMHTGEQPYKCNECGKAFRDC    351 - 420
SGLTAHLLIHTGEKPYKCKECAKVFRHRLSLSNHQRFHTGEKPYRCDECGKDFTRNSNLANHHRIHTGEK    421 - 490
PYKCSECHKVFSHNSHLARHRQIHTGEKSYKCNECGKVFSHKLYLKKHERIHTGEKPYRCHECGKDFTRN    491 - 560
SNLANHHRIHTGEKPYR                                                         561 - 577
//

Text Mined References (5)

PMID Year Title