Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.4e-08
Disease Target Count Z-score Confidence
epididymo-orchitis 8 4.61 2.3
Azoospermia 110 4.042 2.0
Hepatitis E 11 3.466 1.7

AA Sequence

MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPY      1 - 70
QVHISHQEARGPSFKICVGFLGPRWARGCSTGNEKYHLPYAARDLQTFFLPFW                      71 - 123
//

Text Mined References (6)

PMID Year Title