Property Summary

NCBI Gene PubMed Count 28
PubMed Score 16.33
PubTator Score 133.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.300 3.5e-02
intraductal papillary-mucinous carcinoma... 1.400 6.4e-04
intraductal papillary-mucinous neoplasm ... 1.900 8.9e-04
lung cancer 1.200 1.0e-02
ovarian cancer 1.800 2.0e-04
psoriasis -1.800 2.1e-04

Gene RIF (14)

AA Sequence

MAAGVPCALVTSCSSVFSGDQLVQHILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINLCVVPNKFLVT      1 - 70
AEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAKAWLPEVMILVCDRVSEDGINRQKAQEWCIKHGFELVE     71 - 140
LSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHPEQPHL    141 - 210
PAADSTESLSDHRGGASNTTDAQVDSIVDPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLP    211 - 280
HEQRKVHAEKVAKAFWMAIGGDRDEIEGLSSDEEH                                       281 - 315
//

Text Mined References (34)

PMID Year Title