Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $275,893
PubMed Score 3.35
PubTator Score 2.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (2)

PMID Text
24684802 Collectively these data unveil that FBXL19 functions as an antagonist of Rac3 by regulating its stability and regulates the TGFbeta1-induced E-cadherin down-regulation.
20953189 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGMKVPGKGESGPSALLTPPMSSSSRGPGAGARRRRTRCRRCRACVRTECGDCHFCRDMKKFGGPGRMKQ      1 - 70
SCLLRQCTAPVLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEIVHPGCLKMGKAEGVINAEIP     71 - 140
NCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGSGWKLTEEPPLPPPPPRRKGPLPAGPPPEDVPG    141 - 210
PPKRKEREAGNEPPTPRKKVKGGRERHLKKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPE    211 - 280
NWEKPKPPLASAEGPAVPSPSPQREKLERFKRMCQLLERVPDTSSSSSDSDSDSDSSGTSLSEDEAPGEA    281 - 350
RNGRRPARGSSGEKENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGS    351 - 420
DHPLPRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGVVRRQPRALDL    421 - 490
SWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLRWIEDVKDSQLRELLLPPPDT    491 - 560
KPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLV    561 - 630
HLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS          631 - 694
//

Text Mined References (13)

PMID Year Title
24684802 2014 F-box protein complex FBXL19 regulates TGF?1-induced E-cadherin down-regulation by mediating Rac3 ubiquitination and degradation.
22660580 2012 F-box protein FBXL19-mediated ubiquitination and degradation of the receptor for IL-33 limits pulmonary inflammation.
22274791 2013 The genetics of psoriasis and psoriatic arthritis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20953189 2010 Genome-wide association analysis identifies three psoriasis susceptibility loci.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15547684 2004 Identification and characterization of FBXL19 gene in silico.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
More...