Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.60
PubTator Score 1.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.81489312010961E-12
atypical teratoid / rhabdoid tumor 4369 1.55808034656473E-8
lung adenocarcinoma 2714 2.67310852708756E-8
medulloblastoma 1524 1.20316792494982E-7
osteosarcoma 7933 1.77105075259657E-7
ulcerative colitis 2087 2.59227198202545E-7
pilocytic astrocytoma 3086 1.03344066603569E-6
medulloblastoma, large-cell 6234 3.56192638922029E-5
pancreatic cancer 2300 1.40227936815618E-4
ovarian cancer 8492 1.66334070679564E-4
tuberculosis 1563 2.01891647978563E-4
glioblastoma 5572 2.3682761062303E-4
pituitary cancer 1972 5.28005510606172E-4
ductal carcinoma in situ 1745 0.001109026035939
adult high grade glioma 2148 0.00288079464065479
astrocytic glioma 2241 0.00345934766870599
oligodendroglioma 2849 0.00724574465400928
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00814620683228426
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0118881997202619
gastric carcinoma 832 0.0127292787412342
Pick disease 1893 0.0162827344534986
Rheumatoid Arthritis 1171 0.0163191912899818
X-linked cerebral adrenoleukodystrophy 115 0.023004396664478
ependymoma 2514 0.025370460899406
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0344463624246607
adrenocortical carcinoma 1427 0.0427765416487802

Expression

Synonym

Accession Q6PCE3 Q96MQ7 Q9UIK3
Symbols BM32A
PMMLP

Gene

PANTHER Protein Class (2)

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
17804405 Study shows that PGM2L1 which shows 60% homology with PGM2 actually corresponds to glucose-1,6-bisphosphate synthase.

AA Sequence

MAENTEGDLNSNLLHAPYHTGDPQLDTAIGQWLRWDKNPKTKEQIENLLRNGMNKELRDRLCCRMTFGTA      1 - 70
GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAVLLA     71 - 140
KDVPVYLFSRYVPTPFVPYAVQKLKAVAGVMITASHNRKEDNGYKVYWETGAQITSPHDKEILKCIEECV    141 - 210
EPWNGSWNDNLVDTSPLKRDPLQDICRRYMEDLKKICFYRELNSKTTLKFVHTSFHGVGHDYVQLAFKVF    211 - 280
GFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWK    281 - 350
VFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRII    351 - 420
DLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTS    421 - 490
YFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYDSSQPNKKSVLPVSKNSQMITFTFQ    491 - 560
NGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKKLIDALIENFLQPSKNGLIWRSV            561 - 622
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18927083 2008 Mammalian phosphomannomutase PMM1 is the brain IMP-sensitive glucose-1,6-bisphosphatase.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17804405 2007 Molecular identification of mammalian phosphopentomutase and glucose-1,6-bisphosphate synthase, two members of the alpha-D-phosphohexomutase family.
More...