Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.67
PubTator Score 3.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 1.313 8.2e-05
atypical teratoid/rhabdoid tumor 1.100 2.1e-05
glioblastoma 1.200 5.7e-07
group 3 medulloblastoma 1.800 6.5e-06
lung cancer 2.100 2.7e-03
malignant mesothelioma 1.200 3.1e-06
medulloblastoma, large-cell 1.400 9.2e-04
pediatric high grade glioma 1.200 1.8e-05
primitive neuroectodermal tumor 1.500 3.6e-04
psoriasis -1.500 1.4e-03

Gene RIF (8)

AA Sequence

MAHEAMEYDVQVQLNHAEQQPAPAGMASSQGGPALLQPVPADVVSSQGVPSILQPAPAEVISSQATPPLL      1 - 70
QPAPQLSVDLTEVEVLGEDTVENINPRTSEQHRQGSDGNHTIPASSLHSMTNFISGLQRLHGMLEFLRPS     71 - 140
SSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSEELQV    141 - 210
SSSSDSDSDSSAEYGGVVDQAEESGAVILEEQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMD    211 - 280
EEEGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYARTLRAL    281 - 350
DTSEQERMKSSLLKEQMLRKQAELESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQPRGSQAW    351 - 420
VLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVKMLSTANMKSS    421 - 490
QYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSLETNTVVQTYNAGRPVWSCCWCLDEANYIYAGLA    491 - 560
NGSILVYDVRNTSSHVQELVAQKARCPLVSLSYMPRAASAAFPYGGVLAGTLEDASFWEQKMDFSHWPHV    561 - 630
LPLEPGGCIDFQTENSSRHCLVTYRPDKNHTTIRSVLMEMSYRLDDTGNPICSCQPVHTFFGGPTCKLLT    631 - 700
KNAIFQSPENDGNILVCTGDEAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHI    701 - 770
YKWE                                                                      771 - 774
//

Text Mined References (21)

PMID Year Title