Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.90
PubTator Score 3.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -1.500 0.001
glioblastoma 1.200 0.000
group 3 medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.400 0.001
primitive neuroectodermal tumor 1.500 0.000
adrenocortical carcinoma 1.313 0.000
lung cancer 2.100 0.003
pediatric high grade glioma 1.200 0.000
atypical teratoid/rhabdoid tumor 1.100 0.000

Synonym

Accession Q6PCD5 A8K585 B2RE35 D3DUJ8 Q5XKR3 Q9H9Q3 Q9NVT4
Symbols RNF201

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
26474068 RFWD3-dependent ubiquitination of RPA regulates repair at stalled replication forks.
21558276 RFWD3 is recruited to sites of DNA damage and facilitates RPA-mediated DNA damage signaling and repair
21504906 RFWD3 and RPA2 functionally interact and participate in replication checkpoint control
20173098 Study identifies RFWD3 as a positive regulator of p53 stability when the G(1) cell cycle checkpoint is activated and provides an explanation for how p53 is protected from degradation in the presence of high levels of Mdm2.
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAHEAMEYDVQVQLNHAEQQPAPAGMASSQGGPALLQPVPADVVSSQGVPSILQPAPAEVISSQATPPLL      1 - 70
QPAPQLSVDLTEVEVLGEDTVENINPRTSEQHRQGSDGNHTIPASSLHSMTNFISGLQRLHGMLEFLRPS     71 - 140
SSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSEELQV    141 - 210
SSSSDSDSDSSAEYGGVVDQAEESGAVILEEQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMD    211 - 280
EEEGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYARTLRAL    281 - 350
DTSEQERMKSSLLKEQMLRKQAELESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQPRGSQAW    351 - 420
VLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVKMLSTANMKSS    421 - 490
QYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSLETNTVVQTYNAGRPVWSCCWCLDEANYIYAGLA    491 - 560
NGSILVYDVRNTSSHVQELVAQKARCPLVSLSYMPRAASAAFPYGGVLAGTLEDASFWEQKMDFSHWPHV    561 - 630
LPLEPGGCIDFQTENSSRHCLVTYRPDKNHTTIRSVLMEMSYRLDDTGNPICSCQPVHTFFGGPTCKLLT    631 - 700
KNAIFQSPENDGNILVCTGDEAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHI    701 - 770
YKWE                                                                      771 - 774
//

Text Mined References (17)

PMID Year Title
26474068 2015 RFWD3-Dependent Ubiquitination of RPA Regulates Repair at Stalled Replication Forks.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21558276 2011 RING finger and WD repeat domain 3 (RFWD3) associates with replication protein A (RPA) and facilitates RPA-mediated DNA damage response.
21504906 2011 E3 ligase RFWD3 participates in replication checkpoint control.
20173098 2010 RFWD3-Mdm2 ubiquitin ligase complex positively regulates p53 stability in response to DNA damage.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
More...