Property Summary

NCBI Gene PubMed Count 8
PubMed Score 638.62
PubTator Score 289.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 1.508 2.7e-03
lung carcinoma -1.500 7.8e-11
medulloblastoma, large-cell 1.200 3.1e-02

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MRALPGLLEARARTPRLLLLQCLLAAARPSSADGSAPDSPFTSPPLREEIMANNFSLESHNISLTEHSSM      1 - 70
PVEKNITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQLENNYLVSATGSTLYTQYRFTIINSKQMGSY     71 - 140
SCFFREEKEQRGTFNFKVPELHGKNKPLISYVGDSTVLTCKCQNCFPLNWTWYSSNGSVKVPVGVQMNKY    141 - 210
VINGTYANETKLKITQLLEEDGESYWCRALFQLGESEEHIELVVLSYLVPLKPFLVIVAEVILLVATILL    211 - 280
CEKYTQKKKKHSDEGKEFEQIEQLKSDDSNGIENNVPRHRKNESLGQ                           281 - 327
//

Text Mined References (11)

PMID Year Title