Property Summary

NCBI Gene PubMed Count 8
Grant Count 109
R01 Count 27
Funding $36,704,771.37
PubMed Score 633.00
PubTator Score 289.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 1.508 0.003
medulloblastoma, large-cell 1.200 0.031
lung carcinoma -1.500 0.000

Synonym

Accession Q6PCB8 B7Z6S3 B7Z902
Symbols GP70

Gene

EMB

Gene RIF (4)

PMID Text
26090721 embigin is regulated by HOXC8 and its loss plays an important role in the progression of breast tumors
25773908 Study reports elevated expression of Embigin in pancreatic ductal adenocarcinoma and shows its novel functions in regulating cell proliferation, migration, and invasion.
21787388 Data show that Gp70 (embigin) was negative in all normal, adjacent non-neoplastic and PIN lesions and only a very small percentage of cases.
2963822 Reports the original cloning of the mouse embigin gene, referred to as gp70, from embryonal carcinoma cells.

AA Sequence

MRALPGLLEARARTPRLLLLQCLLAAARPSSADGSAPDSPFTSPPLREEIMANNFSLESHNISLTEHSSM      1 - 70
PVEKNITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQLENNYLVSATGSTLYTQYRFTIINSKQMGSY     71 - 140
SCFFREEKEQRGTFNFKVPELHGKNKPLISYVGDSTVLTCKCQNCFPLNWTWYSSNGSVKVPVGVQMNKY    141 - 210
VINGTYANETKLKITQLLEEDGESYWCRALFQLGESEEHIELVVLSYLVPLKPFLVIVAEVILLVATILL    211 - 280
CEKYTQKKKKHSDEGKEFEQIEQLKSDDSNGIENNVPRHRKNESLGQ                           281 - 327
//

Text Mined References (11)

PMID Year Title
26090721 2015 Embigin, regulated by HOXC8, plays a suppressive role in breast tumorigenesis.
25773908 2016 Embigin is overexpressed in pancreatic ductal adenocarcinoma and regulates cell motility through epithelial to mesenchymal transition via the TGF-? pathway.
21787388 2011 Monocarboxylate transporter 4 (MCT4) and CD147 overexpression is associated with poor prognosis in prostate cancer.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9438341 1997 Embigin, a developmentally expressed member of the immunoglobulin super family, is also expressed during regression of prostate and mammary gland.
8700511 1996 Isolation and characterization of genes associated with chromosome-6 mediated tumor suppression in human malignant melanoma.
More...