Property Summary

NCBI Gene PubMed Count 25
Grant Count 63
R01 Count 56
Funding $7,959,358.59
PubMed Score 135.83
PubTator Score 65.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.004
inflammatory breast cancer -1.400 0.000
invasive ductal carcinoma -1.100 0.004

Synonym

Accession Q6PCB7 A6NIH2 B7Z662 FATP-1
Symbols FATP
FATP1
ACSVL5
FATP-1

Gene

PANTHER Protein Class (1)

Gene RIF (14)

PMID Text
25961023 Messenger RNAs for three proteins AATK, SLC27A1, and CDKAL1 are preferentially secreted out in exosomes from HIV-1 Nef-expressing cells, and their targeting miRNAs (miR-32 and miR-93*) are retained in these cells
24120574 Several proteins that are expressed in the epidermis have been proposed to facilitate the uptake of long-chain fatty acids (LCFA) in mammalian cells, CD36, fatty acid binding protein, and FATP. [review]
20965718 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20356843 FATP1 inhibits 11-cis retinol formation via interaction with the visual cycle retinoid isomerase RPE65 and lecithin:retinol acyltransferase
19913121 Observational study of gene-disease association. (HuGE Navigator)
19361580 These data reveals the localization and points to a regulatory function of FATP1 in myotube mitochondria.
18660489 Observational study of gene-disease association. (HuGE Navigator)
15978856 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRR      1 - 70
HQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPE     71 - 140
FVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGDLGP    141 - 210
EGILPDTHLLDPLLKEASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQ    211 - 280
AADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVR    281 - 350
EAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR    351 - 420
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLS    421 - 490
GDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPH    491 - 560
SLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLP    561 - 630
LNEAVYTRICSGAFAL                                                          631 - 646
//

Text Mined References (27)

PMID Year Title
25163924 2014 Insulin sensitivity is independent of lipid binding protein trafficking at the plasma membrane in human skeletal muscle: effect of a 3-day, high-fat diet.
24937540 2014 Association between expression of FABPpm in skeletal muscle and insulin sensitivity in intramyocellular lipid-accumulated nonobese men.
24120574 2014 Fatty acid transporters in skin development, function and disease.
24113382 2013 Overexpression of human fatty acid transport protein 2/very long chain acyl-CoA synthetase 1 (FATP2/Acsvl1) reveals distinct patterns of trafficking of exogenous fatty acids.
23528296 2013 Arylpiperazines as fatty acid transport protein 1 (FATP1) inhibitors with improved potency and pharmacokinetic properties.
23024797 2012 Overexpressed FATP1, ACSVL4/FATP4 and ACSL1 increase the cellular fatty acid uptake of 3T3-L1 adipocytes but are localized on intracellular membranes.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20360315 2010 Genome-wide pharmacogenetics of antidepressant response in the GENDEP project.
More...