Property Summary

NCBI Gene PubMed Count 15
PubMed Score 104.85
PubTator Score 13.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis 1.532 3.9e-03
Astrocytoma, Pilocytic 1.500 6.6e-04
gastric carcinoma 1.300 2.7e-02
lung adenocarcinoma 1.400 9.8e-09

Gene RIF (7)

AA Sequence

MLPWTALGLALSLRLALARSGAERGPPASAPRGDLMFLLDSSASVSHYEFSRVREFVGQLVAPLPLGTGA      1 - 70
LRASLVHVGSRPYTEFPFGQHSSGEAAQDAVRASAQRMGDTHTGLALVYAKEQLFAEASGARPGVPKVLV     71 - 140
WVTDGGSSDPVGPPMQELKDLGVTVFIVSTGRGNFLELSAAASAPAEKHLHFVDVDDLHIIVQELRGSIL    141 - 210
DAMRPQQLHATEITSSGFRLAWPPLLTADSGYYVLELVPSAQPGAARRQQLPGNATDWIWAGLDPDTDYD    211 - 280
VALVPESNVRLLRPQILRVRTRPGEAGPGASGPESGAGPAPTQLAALPAPEEAGPERIVISHARPRSLRV    281 - 350
SWAPALGSAAALGYHVQFGPLRGGEAQRVEVPAGRNCTTLQGLAPGTAYLVTVTAAFRSGRESALSAKAC    351 - 420
TPDGPRPRPRPVPRAPTPGTASREP                                                 421 - 445
//

Text Mined References (18)

PMID Year Title