Property Summary

NCBI Gene PubMed Count 14
Grant Count 14
R01 Count 8
Funding $995,129.12
PubMed Score 95.96
PubTator Score 13.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis 1.532 0.004
pilocytic astrocytoma 1.500 0.001
lung adenocarcinoma 1.400 0.000
gastric carcinoma 1.300 0.027

Gene RIF (7)

PMID Text
26213126 Our results reveal the molecular mechanism of collagen-regulated, A1-mediated platelet adhesion enhancement.
23523902 The VWA1 domain of matrilin-3 is primarily responsible for the induction of IL-6 release from primary human chondrocytes.
23300779 WARP is ideally placed to function as an adapter protein in the cartilage pericellular matrix.
20971096 The distinct localization of WARP in the human and mouse inner ear blood vessels suggests an important role maintaining the integrity of the vasculature.
17187823 Urea was used as a surrogate for shear to study denaturation of the individual VWF recombinant A domains, A1, A2, and A3, and the domain triplet, A1-A2-A3.
16407285 WARP forms macromolecular structures that interact with perlecan to contribute to the assembly and/or maintenance of "permanent" cartilage structures during development and in mature cartilages
14527666 Evolutionary relationship between von Willebrand factor A domain-related protein (WARP), and the fibril-associated collagen with interrupted triple helix (FACIT) and FACIT-like subfamilies of collagens.

AA Sequence

MLPWTALGLALSLRLALARSGAERGPPASAPRGDLMFLLDSSASVSHYEFSRVREFVGQLVAPLPLGTGA      1 - 70
LRASLVHVGSRPYTEFPFGQHSSGEAAQDAVRASAQRMGDTHTGLALVYAKEQLFAEASGARPGVPKVLV     71 - 140
WVTDGGSSDPVGPPMQELKDLGVTVFIVSTGRGNFLELSAAASAPAEKHLHFVDVDDLHIIVQELRGSIL    141 - 210
DAMRPQQLHATEITSSGFRLAWPPLLTADSGYYVLELVPSAQPGAARRQQLPGNATDWIWAGLDPDTDYD    211 - 280
VALVPESNVRLLRPQILRVRTRPGEAGPGASGPESGAGPAPTQLAALPAPEEAGPERIVISHARPRSLRV    281 - 350
SWAPALGSAAALGYHVQFGPLRGGEAQRVEVPAGRNCTTLQGLAPGTAYLVTVTAAFRSGRESALSAKAC    351 - 420
TPDGPRPRPRPVPRAPTPGTASREP                                                 421 - 445
//

Text Mined References (17)

PMID Year Title
26213126 2015 Von Willebrand factor-A1 domain binds platelet glycoprotein Ib? in multiple states with distinctive force-dependent dissociation kinetics.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23523902 2013 The matrilin-3 VWA1 domain modulates interleukin-6 release from primary human chondrocytes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300779 2012 WARP interacts with collagen VI-containing microfibrils in the pericellular matrix of human chondrocytes.
20971096 2011 Immunocytochemical distribution of WARP (von Willebrand A domain-related protein) in the inner ear.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17187823 2007 Conformational stability and domain unfolding of the Von Willebrand factor A domains.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...