Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.78
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6PB30 A6NE22
Symbols CSAGE
CT24.1

Gene

 Compartment GO Term (1)

AA Sequence

MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPKREKGPVKE      1 - 70
VPGTKGSP                                                                   71 - 78
//

Text Mined References (8)

PMID Year Title
23257410 2013 Analysis of compensatory substitution and gene evolution on the MAGEA/CSAG-palindrome of the primate X chromosomes.
21627641 2011 Exome sequencing in a family segregating for celiac disease.
17342728 2008 A shared promoter region suggests a common ancestor for the human VCX/Y, SPANX, and CSAG gene families and the murine CYPT family.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039054 2002 Cancer/testis antigen CSAGE is concurrently expressed with MAGE in chondrosarcoma.