Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.03
PubTator Score 1.00

Knowledge Summary

Patent

No data available

AA Sequence

MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPKREKGPVKE      1 - 70
VPGTKGSP                                                                   71 - 78
//

Text Mined References (8)

PMID Year Title