Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.01
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6P9H5 C9J7B6 D3DWZ4 Q5ZPR6 Q9H612
Symbols IAN2
IAN6
IAN-2
IAN-6

Gene

Gene RIF (2)

PMID Text
23333304 HIV-1 Vif downregulates the expression of GTPase, IMAP family member 6 (GIMAP6) in Vif-expression T cells
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKL      1 - 70
STRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQ     71 - 140
QVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEA    141 - 210
QLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESE    211 - 280
EAHRCLLGKADL                                                              281 - 292
//

Text Mined References (14)

PMID Year Title
23454188 2013 Structural insights into the mechanism of GTPase activation in the GIMAP family.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18462827 2008 Dysregulation of GIMAP genes in non-small cell lung cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474311 2004 Comparative analysis of the human gimap gene cluster encoding a novel GTPase family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...