Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.34
PubTator Score 1.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
adrenocortical carcinoma -1.322 6.3e-03
Astrocytoma, Pilocytic 1.600 5.4e-06
breast carcinoma -1.300 8.8e-05
colon cancer -1.400 4.0e-02
cutaneous lupus erythematosus 1.100 1.7e-02
dermatomyositis 1.400 2.3e-03
ductal carcinoma in situ -1.200 1.0e-03
gastric cancer 1.500 2.8e-03
glioblastoma 1.100 1.4e-04
hepatocellular carcinoma 2.100 4.2e-06
intraductal papillary-mucinous adenoma (... -2.000 9.1e-04
intraductal papillary-mucinous carcinoma... -2.600 1.6e-04
intraductal papillary-mucinous neoplasm ... -2.800 1.8e-03
invasive ductal carcinoma -1.700 4.0e-03
juvenile dermatomyositis 1.353 6.9e-09
lung adenocarcinoma -1.600 5.2e-16
lung cancer -2.600 6.1e-06
lung carcinoma -1.600 6.1e-12
medulloblastoma, large-cell -1.800 7.8e-04
non-small cell lung cancer -2.396 2.8e-21
osteosarcoma -1.791 1.5e-02
ovarian cancer -2.400 3.8e-05
pancreatic cancer 1.200 1.5e-02
pancreatic carcinoma 1.200 1.5e-02
pancreatic ductal adenocarcinoma liver m... -1.440 1.1e-02
pediatric high grade glioma 1.200 1.3e-03
primary Sjogren syndrome 2.000 1.6e-03
psoriasis -1.500 1.5e-04
sarcoidosis 1.400 9.6e-03
spina bifida 1.107 3.9e-02
subependymal giant cell astrocytoma 1.407 4.4e-02
ulcerative colitis 1.700 2.0e-04

Synonym

Accession Q6P9H5 C9J7B6 D3DWZ4 Q5ZPR6 Q9H612
Symbols IAN2
IAN6
IAN-2
IAN-6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKL      1 - 70
STRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQ     71 - 140
QVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEA    141 - 210
QLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESE    211 - 280
EAHRCLLGKADL                                                              281 - 292
//

Text Mined References (16)

PMID Year Title