Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.17
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 0.000

Gene RIF (2)

PMID Text
25546433 During chondrogenic differentiation of human mesenchymal stem cells, ZNF449 was increased at an early stage, and its overexpression enhanced SOX9 and SOX6 only at the initial stage of the differentiation.
16636917 ZNF449 is a member of the zinc-finger family and it may function as a transcription factor

AA Sequence

MAVALGCAIQASLNQGSVFQEYDTDCEVFRQRFRQFQYREAAGPHEAFNKLWELCCQWLKPKMRSKEQIL      1 - 70
ELLVLEQFLTILPTEIETWVREHCPENRERVVSLIEDLQRELEIPEQQVDMHDMLLEELAPVGTAHIPPT     71 - 140
MHLESPALQVMGPAQEAPVAEAWIPQAGPPELNYGATGECQNFLDPGYPLPKLDMNFSLENREEPWVKEL    141 - 210
QDSKEMKQLLDSKIGFEIGIENEEDTSKQKKMETMYPFIVTLEGNALQGPILQKDYVQLENQWETPPEDL    211 - 280
QTDLAKLVDQQNPTLGETPENSNLEEPLNPKPHKKKSPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEP    281 - 350
HKCPECGKRFLRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGS    351 - 420
SLKRHLKTHTGEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVIHLRIHTGEKP    421 - 490
YKCTHCSKSFRQRAGLIMHQVTHFRGLI                                              491 - 518
//

Text Mined References (10)

PMID Year Title
25546433 2014 Identification of SCAN domain zinc-finger gene ZNF449 as a novel factor of chondrogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16636917 2006 Identification and characterization of the human SCAN domain zinc-finger gene ZNF449.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.