Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.89
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.05242277631969E-22
nasopharyngeal carcinoma 1056 4.34394449777585E-6
cystic fibrosis 1670 3.06016303395091E-5
ulcerative colitis 2087 4.2173885954224E-5
pancreatic cancer 2300 6.12554430712904E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.47251050846128E-4
ductal carcinoma in situ 1745 0.00140683788137821
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00207683778225634
interstitial cystitis 2299 0.00849729259240721
Endometriosis 535 0.0134001448074975
osteosarcoma 7933 0.0240197229890068
spina bifida 1064 0.0323716509320221
Disease Target Count Z-score Confidence
Mastitis 48 3.036 1.5

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.998 0.024
cystic fibrosis 3.064 0.000
intraductal papillary-mucinous adenoma (... 2.500 0.000
intraductal papillary-mucinous neoplasm ... 2.900 0.002
pancreatic cancer 1.300 0.000
interstitial cystitis -1.400 0.008
nasopharyngeal carcinoma -1.200 0.000
Endometriosis -1.778 0.013
lung carcinoma -2.600 0.000
spina bifida -1.540 0.032
ductal carcinoma in situ 1.300 0.001
ulcerative colitis 1.700 0.000

Synonym

Accession Q6P9G4 Q8WUT7 Q96MQ8
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken EggNOG Inparanoid

Gene RIF (1)

PMID Text
25799151 the diabetogenic impact of the C-allele of TMEM154-rs6813195 is mediated through reduced beta cell function.

AA Sequence

MQAPRAALVFALVIALVPVGRGNYEELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPD      1 - 70
ENQLEFILMVLIPLILLVLLLLSVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPS     71 - 140
VMEIEMEELDKWMNSMNRNADFECLPTLKEEKESNHNPSDSES                               141 - 183
//

Text Mined References (8)

PMID Year Title
25799151 2015 The type 2 diabetes risk allele of TMEM154-rs6813195 associates with decreased beta cell function in a study of 6,486 Danes.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.