Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.89
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.998 0.024
cystic fibrosis 3.064 0.000
intraductal papillary-mucinous adenoma (... 2.500 0.000
intraductal papillary-mucinous neoplasm ... 2.900 0.002
pancreatic cancer 1.300 0.000
interstitial cystitis -1.400 0.008
nasopharyngeal carcinoma -1.200 0.000
Endometriosis -1.778 0.013
lung carcinoma -2.600 0.000
spina bifida -1.540 0.032
ductal carcinoma in situ 1.300 0.001
ulcerative colitis 1.700 0.000

Gene RIF (1)

PMID Text
25799151 the diabetogenic impact of the C-allele of TMEM154-rs6813195 is mediated through reduced beta cell function.

AA Sequence

MQAPRAALVFALVIALVPVGRGNYEELENSGDTTVESERPNKVTIPSTFAAVTIKETLNANINSTNFAPD      1 - 70
ENQLEFILMVLIPLILLVLLLLSVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPS     71 - 140
VMEIEMEELDKWMNSMNRNADFECLPTLKEEKESNHNPSDSES                               141 - 183
//

Text Mined References (8)

PMID Year Title
25799151 2015 The type 2 diabetes risk allele of TMEM154-rs6813195 associates with decreased beta cell function in a study of 6,486 Danes.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.