Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.25
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6P9G0 D3DTQ8 Q96DM7
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MPRRGLVAGPDLEYFQRRYFTPAEVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDIS      1 - 70
HWFDPKTRDIRKHIDPLTGCLRYCTPRGRFVHVPPQLPCSDWANDFGKPWWQGSYYEVGRLSAKTRSIRI     71 - 140
INTLTSQEHTLEVGVLESIWEILHRYLPYNSHAASYTWKYEGKNLNMDFTLEENGIRDEEEEFDYLSMDG    141 - 210
TLHTPAILLYFNDDLTEL                                                        211 - 228
//

Text Mined References (4)

PMID Year Title