Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.25
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MPRRGLVAGPDLEYFQRRYFTPAEVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDIS      1 - 70
HWFDPKTRDIRKHIDPLTGCLRYCTPRGRFVHVPPQLPCSDWANDFGKPWWQGSYYEVGRLSAKTRSIRI     71 - 140
INTLTSQEHTLEVGVLESIWEILHRYLPYNSHAASYTWKYEGKNLNMDFTLEENGIRDEEEEFDYLSMDG    141 - 210
TLHTPAILLYFNDDLTEL                                                        211 - 228
//

Text Mined References (4)

PMID Year Title