Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.63
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.493 2.4e-05
adult high grade glioma -1.800 3.4e-02
astrocytic glioma -2.600 1.1e-03
Astrocytoma, Pilocytic -1.400 2.9e-02
atypical teratoid / rhabdoid tumor -3.700 3.4e-06
ependymoma -3.300 1.9e-03
glioblastoma -1.900 1.8e-04
group 3 medulloblastoma -2.600 3.9e-02
intraductal papillary-mucinous neoplasm ... 1.600 9.7e-03
lung cancer 1.200 5.4e-04
medulloblastoma, large-cell -3.200 9.7e-04
oligodendroglioma -2.800 4.1e-03
osteosarcoma -1.622 5.4e-04
ovarian cancer 1.300 2.5e-05
Pick disease -1.900 2.2e-03
primitive neuroectodermal tumor -2.400 5.0e-03
psoriasis 1.100 3.0e-05

Gene RIF (3)

AA Sequence

MITLTELKCLADAQSSYHILKPWWDVFWYYITLIMLLVAVLAGALQLTQSRVLCCLPCKVEFDNHCAVPW      1 - 70
DILKASMNTSSNPGTPLPLPLRIQNDLHRQQYSYIDAVCYEKQLHWFAKFFPYLVLLHTLIFAACSNFWL     71 - 140
HYPSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSSSGCSADIDSGKQSLPYPQ    141 - 210
PGLESAGIESPTSSVLDKKEGEQAKAIFEKVKRFRMHVEQKDIIYRVYLKQIIVKVILFVLIITYVPYFL    211 - 280
THITLEIDCSVDVQAFTGYKRYQCVYSLAEIFKVLASFYVILVILYGLTSSYSLWWMLRSSLKQYSFEAL    281 - 350
REKSNYSDIPDVKNDFAFILHLADQYDPLYSKRFSIFLSEVSENKLKQINLNNEWTVEKLKSKLVKNAQD    351 - 420
KIELHLFMLNGLPDNVFELTEMEVLSLELIPEVKLPSAVSQLVNLKELRVYHSSLVVDHPALAFLEENLK    421 - 490
ILRLKFTEMGKIPRWVFHLKNLKELYLSGCVLPEQLSTMQLEGFQDLKNLRTLYLKSSLSRIPQVVTDLL    491 - 560
PSLQKLSLDNEGSKLVVLNNLKKMVNLKSLELISCDLERIPHSIFSLNNLHELDLRENNLKTVEEIISFQ    561 - 630
HLQNLSCLKLWHNNIAYIPAQIGALSNLEQLSLDHNNIENLPLQLFLCTKLHYLDLSYNHLTFIPEEIQY    631 - 700
LSNLQYFAVTNNNIEMLPDGLFQCKKLQCLLLGKNSLMNLSPHVGELSNLTHLELIGNYLETLPPELEGC    701 - 770
QSLKRNCLIVEENLLNTLPLPVTERLQTCLDKC                                         771 - 803
//

Text Mined References (11)

PMID Year Title