Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.99
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.600 0.001
ependymoma -3.300 0.002
oligodendroglioma -2.800 0.004
psoriasis 1.400 0.000
glioblastoma -3.400 0.000
osteosarcoma -1.622 0.001
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -3.200 0.001
primitive neuroectodermal tumor -2.400 0.005
adrenocortical carcinoma -1.493 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.010
lung cancer 1.200 0.001
pediatric high grade glioma -2.300 0.002
pilocytic astrocytoma -1.300 0.033
Pick disease -1.900 0.002
ovarian cancer 1.300 0.000

Synonym

Accession Q6P9F7 D3DT28 Q6UY21 Q8N106 Q92627
Symbols TALRRP
TA-LRRP

Gene

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15094057 identified four genes, named TA-LRRP, AD158, LRRC5, and FLJ23420, as unknown LRRC8-like genes

AA Sequence

MITLTELKCLADAQSSYHILKPWWDVFWYYITLIMLLVAVLAGALQLTQSRVLCCLPCKVEFDNHCAVPW      1 - 70
DILKASMNTSSNPGTPLPLPLRIQNDLHRQQYSYIDAVCYEKQLHWFAKFFPYLVLLHTLIFAACSNFWL     71 - 140
HYPSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSSSGCSADIDSGKQSLPYPQ    141 - 210
PGLESAGIESPTSSVLDKKEGEQAKAIFEKVKRFRMHVEQKDIIYRVYLKQIIVKVILFVLIITYVPYFL    211 - 280
THITLEIDCSVDVQAFTGYKRYQCVYSLAEIFKVLASFYVILVILYGLTSSYSLWWMLRSSLKQYSFEAL    281 - 350
REKSNYSDIPDVKNDFAFILHLADQYDPLYSKRFSIFLSEVSENKLKQINLNNEWTVEKLKSKLVKNAQD    351 - 420
KIELHLFMLNGLPDNVFELTEMEVLSLELIPEVKLPSAVSQLVNLKELRVYHSSLVVDHPALAFLEENLK    421 - 490
ILRLKFTEMGKIPRWVFHLKNLKELYLSGCVLPEQLSTMQLEGFQDLKNLRTLYLKSSLSRIPQVVTDLL    491 - 560
PSLQKLSLDNEGSKLVVLNNLKKMVNLKSLELISCDLERIPHSIFSLNNLHELDLRENNLKTVEEIISFQ    561 - 630
HLQNLSCLKLWHNNIAYIPAQIGALSNLEQLSLDHNNIENLPLQLFLCTKLHYLDLSYNHLTFIPEEIQY    631 - 700
LSNLQYFAVTNNNIEMLPDGLFQCKKLQCLLLGKNSLMNLSPHVGELSNLTHLELIGNYLETLPPELEGC    701 - 770
QSLKRNCLIVEENLLNTLPLPVTERLQTCLDKC                                         771 - 803
//

Text Mined References (11)

PMID Year Title
26824658 2016 LRRC8 Proteins Form Volume-Regulated Anion Channels that Sense Ionic Strength.
24790029 2014 Identification of LRRC8 heteromers as an essential component of the volume-regulated anion channel VRAC.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22532330 2012 LRRC8 proteins share a common ancestor with pannexins, and may form hexameric channels involved in cell-cell communication.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15094057 2004 LRRC8 involved in B cell development belongs to a novel family of leucine-rich repeat proteins.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
More...