Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.30
PubTator Score 0.98

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (3)

PMID Text
21474709 findings suggest that TRIM40 inhibits NF-kappaB activity via neddylation of inhibitor of nuclear factor kappaB kinase subunit gamma and that TRIM40 prevents inflammation-associated carcinogenesis in the gastrointestinal tract
20593013 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYI      1 - 70
CPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQE     71 - 140
KKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLE    141 - 210
RTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL                          211 - 258
//

Text Mined References (9)

PMID Year Title
24489884 2014 Genome-wide association study of proneness to anger.
21474709 2011 TRIM40 promotes neddylation of IKK? and is downregulated in gastrointestinal cancers.
20593013 2010 A major histocompatibility Class I locus contributes to multiple sclerosis susceptibility independently from HLA-DRB1*15:01.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12622776 2003 Cluster of TRIM genes in the human MHC class I region sharing the B30.2 domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.