Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.19
PubTator Score 15.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.034 0.000

Gene RIF (6)

PMID Text
25818163 our findings support the conclusion that the rs12817488 in CCDC62/HIP1R polymorphism may increase the risk of Parkinson's disease in the Chinese Han population.
24335092 Study demonstrated a significant association between rs12817488 and sporadic Parkinson's disease with gender variations in a Chinese cohort
24312176 STK39 (rs2102808) and CCDC62/HIP1R (rs12817488) do not appear to influence PD risk.
19165854 serological survey of 191 cancer patients with a range of different cancers by ELISA revealed antibodies to CCDC62-2 in 13 patients, including stomach cancer
19126643 Role of CCDC62/ERAP75 as a novel coactivator in prostate cancer cells that can modulate estrogen receptor beta transactivation and receptor function.
18563714 ERAP75 functions as a novel coactivator that can modulate ER alpha function in the prostate stromal cells.

AA Sequence

MNPPAAFLAGRQNIGSEVEISTIEKQRKELQLLIGELKDRDKELNDMVAVHQQQLLSWEEDRQKVLTLEE      1 - 70
RCSKLEGELHKRTEIIRSLTKKVKALESNQMECQTALQKTQLQLQEMAQKATHSSLLSEDLEARNETLSN     71 - 140
TLVELSAQVGQLQAREQALTTMIKLKDKDIIEAVNHIADCSGKFKMLEHALRDAKMAETCIVKEKQDYKQ    141 - 210
KLKALKIEVNKLKEDLNEKTTENNEQREEIIRLKQEKSCLHDELLFTVEREKRKDELLNIAKSKQERTNS    211 - 280
ELHNLRQIYVKQQSDLQFLNFNVENSQELIQMYDSKMEESKALDSSRDMCLSDLENNHPKVDIKREKNQK    281 - 350
SLFKDQKFEAMLVQQNRSDKSSCDECKEKKQQIDTVFGEKSVITLSSIFTKDLVEKHNLPWSLGGKTQIE    351 - 420
PENKITLCKIHTKSPKCHGTGVQNEGKQPSETPTLSDEKQWHDVSVYLGLTNCPSSKHPEKLDVECQDQM    421 - 490
ERSEISCCQKNEACLGESGMCDSKCCHPSNFIIEAPGHMSDVEWMSIFKPSKMQRIVRLKSGCTCSESIC    491 - 560
GTQHDSPASELIAIQDSHSLGSSKSALREDETESSSNKKNSPTSLLIYKDAPAFNEKASIVLPSQDDFSP    561 - 630
TSKLQRLLAESRQMVTDLELSTLLPISHENLTGSATNKSEVPEESAQKNTFVSY                    631 - 684
//

Text Mined References (13)

PMID Year Title
25818163 2015 The single nucleotide polymorphism Rs12817488 is associated with Parkinson's disease in the Chinese population.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24335092 2014 CCDC62 variant rs12817488 is associated with the risk of Parkinson's disease in a Han Chinese population.
24312176 2013 Genetic association study between STK39 and CCDC62/HIP1R and Parkinson's disease.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
19165854 2009 Identification of CCDC62-2 as a novel cancer/testis antigen and its immunogenicity.
19126643 2009 CCDC62/ERAP75 functions as a coactivator to enhance estrogen receptor beta-mediated transactivation and target gene expression in prostate cancer cells.
18563714 2008 ERAP75 functions as a coactivator to enhance estrogen receptor alpha transactivation in prostate stromal cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...