Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.394 4.2e-06
cystic fibrosis 1.229 3.0e-05
interstitial cystitis -1.100 2.7e-05
intraductal papillary-mucinous neoplasm ... 1.600 4.6e-03
malignant mesothelioma -1.300 3.1e-05
osteosarcoma 1.171 5.5e-05
ovarian cancer -1.300 1.1e-05
psoriasis 1.100 1.2e-02

Synonym

Accession Q6P9B6 Q8IZ64 Q9HCG3 Q9NTE8
Symbols KIAA1609

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPPEMVTRLYDGM      1 - 70
RRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGPVKAREVQKFTEDLVGSVVHV     71 - 140
LSHRQELRGWTGKEAPGPNPRVQVLAAQLLSDMKLQDGKRLLGPQWLDYDCDRAVIEDWVFRVPHVAIFL    141 - 210
SVVICKGFLILCSSLDLTTLVPERQVDQGRGFESILDVLSVMYINAQLPREQRHRWCLLFSSELHGHSFS    211 - 280
QLCGHITHRGPCVAVLEDHDKHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNH    281 - 350
GQQTIPNGLGMGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLA    351 - 420
KGNKSILDADPEAQALLEISGHSRHSEGLREVPDDE                                      421 - 456
//

Text Mined References (15)

PMID Year Title