Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis 1.100 0.012
osteosarcoma 1.171 0.000
cystic fibrosis 1.519 0.000
adrenocortical carcinoma 1.394 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.005
interstitial cystitis -1.100 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q6P9B6 Q8IZ64 Q9HCG3 Q9NTE8
Symbols KIAA1609

Gene

AA Sequence

MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPPEMVTRLYDGM      1 - 70
RRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGPVKAREVQKFTEDLVGSVVHV     71 - 140
LSHRQELRGWTGKEAPGPNPRVQVLAAQLLSDMKLQDGKRLLGPQWLDYDCDRAVIEDWVFRVPHVAIFL    141 - 210
SVVICKGFLILCSSLDLTTLVPERQVDQGRGFESILDVLSVMYINAQLPREQRHRWCLLFSSELHGHSFS    211 - 280
QLCGHITHRGPCVAVLEDHDKHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNH    281 - 350
GQQTIPNGLGMGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLA    351 - 420
KGNKSILDADPEAQALLEISGHSRHSEGLREVPDDE                                      421 - 456
//

Text Mined References (14)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
19060904 2009 An empirical framework for binary interactome mapping.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...