Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
ependymoma -2.000 0.036
oligodendroglioma -1.600 0.040
glioblastoma -2.100 0.000
medulloblastoma -2.200 0.000
cystic fibrosis 1.413 0.000
atypical teratoid / rhabdoid tumor -1.800 0.010
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.500 0.022
Atopic dermatitis -1.400 0.002
adrenocortical carcinoma -1.721 0.007
non-small cell lung cancer 1.016 0.000
intraductal papillary-mucinous adenoma (... -1.900 0.004
intraductal papillary-mucinous carcinoma... -1.800 0.006
sarcoidosis 1.300 0.010
pediatric high grade glioma -1.300 0.004
psoriasis -1.200 0.000
lung carcinoma 4.700 0.000
Breast cancer -1.500 0.001
ulcerative colitis 1.200 0.006
ovarian cancer -2.500 0.000

AA Sequence

MARLCRRVPCTLLLGLAVVLLKARLVPAAARAELSRSDLSLIQQQQQQQQQQQQQQKQLEEAEEERTEVP      1 - 70
GATSTLTVPVSVFMLKVQVNDIISRQYLSQAVVEVFVNYTKTNSTVTKSNGAVLIKVPYKLGLSLTIIAY     71 - 140
KDGYVLTPLPWKTRRMPIYSSVTLSLFPQSQANIWLFEDTVLITGKLADAKSQPSVQFSKALIKLPDNHH    141 - 210
ISNVTGYLTVLQQFLKVDNFLHTTGITLNKPGFENIELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRL    211 - 280
NDISAGDRIPAWTFDMNTGAWVNHGRGMVKEHNNHLIWTYDAPHLGYWIAAPLPGTRGSGINEDSKDITA    281 - 350
YHTVFLTAILGGTIVIVIGFFAVLLCYCRDKCGTPQKRERNITKLEVLKRDQTTSTTHINHISTVKVALK    351 - 420
AEDKSQLFNAKNSSYSPQKKEPSKAETEERVSMVKTRDDFKIYNEDVSFLSVNQNNYSRNPTQSLEPNVG    421 - 490
SKQPKHINNNLSSSLGDAQDEKRYLTGNEEAYGRSHIPEQLMHIYSQPIAILQTSDLFSTPEQLHTAKSA    491 - 560
TLPRKGQLVYGQLMEPVNRENFTQTLPKMPIHSHAQPPDAREEDIILEGQQSLPSQASDWSRYSSSLLES    561 - 630
VSVPGTLNEAVVMTPFSSELQGISEQTLLELSKGKPSPHPRAWFVSLDGKPVAQVRHSFIDLKKGKRTQS    631 - 700
NDTSLDSGVDMNELHSSRKLEREKTFIKSMHQPKILYLEDLDLSSSESGTTVCSPEDPALRHILDGGSGV    701 - 770
IMEHPGEESPGRKSTVEDFEANTSPTKRRGRPPLAKRDSKTNIWKKREERPLIPIN                  771 - 826
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.