Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.721 7.2e-03
adult high grade glioma -1.300 3.7e-03
Atopic dermatitis -1.400 1.7e-03
atypical teratoid / rhabdoid tumor -1.800 9.5e-03
Breast cancer -1.500 9.1e-04
cystic fibrosis 1.413 6.1e-06
ependymoma -2.000 3.6e-02
glioblastoma -1.100 1.2e-03
group 3 medulloblastoma -2.000 5.9e-03
intraductal papillary-mucinous adenoma (... -1.900 3.5e-03
intraductal papillary-mucinous carcinoma... -1.800 6.2e-03
lung carcinoma 4.700 1.3e-46
medulloblastoma, large-cell -3.000 6.3e-06
non-small cell lung cancer 1.016 3.9e-07
oligodendroglioma -1.600 4.0e-02
ovarian cancer -2.500 2.1e-05
primitive neuroectodermal tumor -1.500 2.2e-02
psoriasis -1.100 1.7e-20
sarcoidosis 1.300 9.5e-03
ulcerative colitis 1.200 6.1e-03

AA Sequence

MARLCRRVPCTLLLGLAVVLLKARLVPAAARAELSRSDLSLIQQQQQQQQQQQQQQKQLEEAEEERTEVP      1 - 70
GATSTLTVPVSVFMLKVQVNDIISRQYLSQAVVEVFVNYTKTNSTVTKSNGAVLIKVPYKLGLSLTIIAY     71 - 140
KDGYVLTPLPWKTRRMPIYSSVTLSLFPQSQANIWLFEDTVLITGKLADAKSQPSVQFSKALIKLPDNHH    141 - 210
ISNVTGYLTVLQQFLKVDNFLHTTGITLNKPGFENIELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRL    211 - 280
NDISAGDRIPAWTFDMNTGAWVNHGRGMVKEHNNHLIWTYDAPHLGYWIAAPLPGTRGSGINEDSKDITA    281 - 350
YHTVFLTAILGGTIVIVIGFFAVLLCYCRDKCGTPQKRERNITKLEVLKRDQTTSTTHINHISTVKVALK    351 - 420
AEDKSQLFNAKNSSYSPQKKEPSKAETEERVSMVKTRDDFKIYNEDVSFLSVNQNNYSRNPTQSLEPNVG    421 - 490
SKQPKHINNNLSSSLGDAQDEKRYLTGNEEAYGRSHIPEQLMHIYSQPIAILQTSDLFSTPEQLHTAKSA    491 - 560
TLPRKGQLVYGQLMEPVNRENFTQTLPKMPIHSHAQPPDAREEDIILEGQQSLPSQASDWSRYSSSLLES    561 - 630
VSVPGTLNEAVVMTPFSSELQGISEQTLLELSKGKPSPHPRAWFVSLDGKPVAQVRHSFIDLKKGKRTQS    631 - 700
NDTSLDSGVDMNELHSSRKLEREKTFIKSMHQPKILYLEDLDLSSSESGTTVCSPEDPALRHILDGGSGV    701 - 770
IMEHPGEESPGRKSTVEDFEANTSPTKRRGRPPLAKRDSKTNIWKKREERPLIPIN                  771 - 826
//

Text Mined References (6)

PMID Year Title