Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.31494900910127E-46
psoriasis 6685 1.56799242872469E-9
non-small cell lung cancer 2798 3.94087391535826E-7
medulloblastoma 1524 1.42794389909594E-6
cystic fibrosis 1670 6.07121547064055E-6
medulloblastoma, large-cell 6234 6.2809137361923E-6
ovarian cancer 8492 2.10497603448298E-5
glioblastoma 5572 2.99585491515447E-4
Breast cancer 3099 9.14543328090329E-4
Atopic dermatitis 944 0.00173950529830583
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00352065604101828
pediatric high grade glioma 2712 0.00401269917232204
ulcerative colitis 2087 0.0060633024985325
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00624809707694716
adrenocortical carcinoma 1427 0.0071753234440986
atypical teratoid / rhabdoid tumor 4369 0.00951102370017646
sarcoidosis 368 0.00953595577399024
primitive neuroectodermal tumor 3031 0.0218736432048559
ependymoma 2514 0.0362557034544653
oligodendroglioma 2849 0.040446180600059
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (20)

Disease log2 FC p
ependymoma -2.000 0.036
oligodendroglioma -1.600 0.040
glioblastoma -2.100 0.000
medulloblastoma -2.200 0.000
cystic fibrosis 1.413 0.000
atypical teratoid / rhabdoid tumor -1.800 0.010
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.500 0.022
Atopic dermatitis -1.400 0.002
adrenocortical carcinoma -1.721 0.007
non-small cell lung cancer 1.016 0.000
intraductal papillary-mucinous adenoma (... -1.900 0.004
intraductal papillary-mucinous carcinoma... -1.800 0.006
sarcoidosis 1.300 0.010
pediatric high grade glioma -1.300 0.004
psoriasis -1.200 0.000
lung carcinoma 4.700 0.000
Breast cancer -1.500 0.001
ulcerative colitis 1.200 0.006
ovarian cancer -2.500 0.000

Synonym

Accession Q6P995 Q53SK3 Q8N1Y4 Q8N3K1 Q8N970 Q8NB81 Q8TF55 Q8WYR8
Symbols KIAA1946

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

AA Sequence

MARLCRRVPCTLLLGLAVVLLKARLVPAAARAELSRSDLSLIQQQQQQQQQQQQQQKQLEEAEEERTEVP      1 - 70
GATSTLTVPVSVFMLKVQVNDIISRQYLSQAVVEVFVNYTKTNSTVTKSNGAVLIKVPYKLGLSLTIIAY     71 - 140
KDGYVLTPLPWKTRRMPIYSSVTLSLFPQSQANIWLFEDTVLITGKLADAKSQPSVQFSKALIKLPDNHH    141 - 210
ISNVTGYLTVLQQFLKVDNFLHTTGITLNKPGFENIELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRL    211 - 280
NDISAGDRIPAWTFDMNTGAWVNHGRGMVKEHNNHLIWTYDAPHLGYWIAAPLPGTRGSGINEDSKDITA    281 - 350
YHTVFLTAILGGTIVIVIGFFAVLLCYCRDKCGTPQKRERNITKLEVLKRDQTTSTTHINHISTVKVALK    351 - 420
AEDKSQLFNAKNSSYSPQKKEPSKAETEERVSMVKTRDDFKIYNEDVSFLSVNQNNYSRNPTQSLEPNVG    421 - 490
SKQPKHINNNLSSSLGDAQDEKRYLTGNEEAYGRSHIPEQLMHIYSQPIAILQTSDLFSTPEQLHTAKSA    491 - 560
TLPRKGQLVYGQLMEPVNRENFTQTLPKMPIHSHAQPPDAREEDIILEGQQSLPSQASDWSRYSSSLLES    561 - 630
VSVPGTLNEAVVMTPFSSELQGISEQTLLELSKGKPSPHPRAWFVSLDGKPVAQVRHSFIDLKKGKRTQS    631 - 700
NDTSLDSGVDMNELHSSRKLEREKTFIKSMHQPKILYLEDLDLSSSESGTTVCSPEDPALRHILDGGSGV    701 - 770
IMEHPGEESPGRKSTVEDFEANTSPTKRRGRPPLAKRDSKTNIWKKREERPLIPIN                  771 - 826
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.