Property Summary

NCBI Gene PubMed Count 5
Grant Count 13
R01 Count 10
Funding $1,436,404.5
PubMed Score 149.51
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Dentin dysplasia 19 3.74 1.9
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Gene RIF (3)

PMID Text
26517809 Data show that notum and glypican-1 and glypican-3 gene expression during colorectal cancer (CRC) development and present evidence to suggest them as potential new biomarkers of CRC pathogenesis.
25731175 Kinetic and mass spectrometric analyses of human proteins show that Notum is a carboxylesterase that removes an essential palmitoleate moiety from Wnt proteins and thus constitutes the first known extracellular protein deacylase
18429952 Overexpression of NOTUM is associated with hepatocellular carcinoma

AA Sequence

MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVEGNMDSFMAQV      1 - 70
KSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRY     71 - 140
DTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQE    141 - 210
VVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCV    211 - 280
DTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVH    281 - 350
LTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHD    351 - 420
SHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLG    421 - 490
MLSNGS                                                                    491 - 496
//

Text Mined References (9)

PMID Year Title
26517809 2015 Novel insights into Notum and glypicans regulation in colorectal cancer.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25731175 2015 Notum deacylates Wnt proteins to suppress signalling activity.
18429952 2008 Human homolog of NOTUM, overexpressed in hepatocellular carcinoma, is regulated transcriptionally by beta-catenin/TCF.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12015973 2002 HSPG modification by the secreted enzyme Notum shapes the Wingless morphogen gradient.