Property Summary

NCBI Gene PubMed Count 17
PubMed Score 36.77
PubTator Score 14.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.261 1.1e-02
ovarian cancer -1.100 2.0e-05
pancreatic ductal adenocarcinoma liver m... -1.281 1.0e-02

Gene RIF (8)

AA Sequence

MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYPVSGAKRKYQEDSDPERSD      1 - 70
YEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYT     71 - 140
YGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHI    141 - 210
FERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVI    211 - 280
ILRKTRLDAPRLETKSLSSSVLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRS    281 - 350
VLLPTHRRRGSFSSENYWRKSYESSEDCSEAAGSPARKVKMRRH                              351 - 394
//

Text Mined References (31)

PMID Year Title