Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
R01 Count 1
Funding $526,764.25
PubMed Score 31.47
PubTator Score 14.64

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.535 0.002
pancreatic ductal adenocarcinoma liver m... -1.281 0.010
ovarian cancer 1.500 0.000

Synonym

Accession Q6P6C2 B4DVJ4 D3DXC6 Q9NXD6
Symbols ABH5
OFOXD
OFOXD1

Gene

PDB

4NJ4   4NRM   4NRO   4NRP   4NRQ   4O61   4O7X   4OCT  

Gene RIF (6)

PMID Text
26047305 The ALKBH5 gene may play a role in conferring risk of MDD in the Chinese population.
24778178 Structures of human ALKBH5 demethylase reveal a unique binding mode for specific single-stranded N6-methyladenosine RNA demethylation.
24616105 findings provide a structural basis for understanding the substrate recognition specificity of Alkbh5 and offer a foundation for selective drug design against AlkB members
24489119 Modelling substrate into the active site of ALKBH5 reveals conserved residues important for recognition and demethylation mechanisms.
23177736 ALKBH5 is a RNA demethylase and its action strongly suggests that the reversible methyladenosine modification has fundamental and broad functions in mammalian cells.
21264265 ALKBH5 may have a role in the regulation of cellular responses to hypoxia as a class of HIF-transcriptional target gene

AA Sequence

MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYPVSGAKRKYQEDSDPERSD      1 - 70
YEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYT     71 - 140
YGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHI    141 - 210
FERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVI    211 - 280
ILRKTRLDAPRLETKSLSSSVLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRS    281 - 350
VLLPTHRRRGSFSSENYWRKSYESSEDCSEAAGSPARKVKMRRH                              351 - 394
//

Text Mined References (28)

PMID Year Title
26047305 2015 An association study of the m6A genes with major depressive disorder in Chinese Han population.
24778178 2014 Structures of human ALKBH5 demethylase reveal a unique binding mode for specific single-stranded N6-methyladenosine RNA demethylation.
24616105 2014 Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition.
24489119 2014 Structure of human RNA N?-methyladenine demethylase ALKBH5 provides insights into its mechanisms of nucleic acid recognition and demethylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23177736 2013 ALKBH5 is a mammalian RNA demethylase that impacts RNA metabolism and mouse fertility.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...