Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.09
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.1e-03
gastric carcinoma 807 1.7e-02
invasive ductal carcinoma 2951 1.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
gastric carcinoma -1.100 1.7e-02
invasive ductal carcinoma 1.100 1.7e-02
ovarian cancer 1.100 2.1e-03

Synonym

Accession Q6P6B7 A6NEF0 F8WEI4 Q9NT01
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

AA Sequence

MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRD      1 - 70
YKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNS     71 - 140
FHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALM    141 - 210
DAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHY    211 - 280
AAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRAD    281 - 350
VLQGSGHSAMT                                                               351 - 361
//

Text Mined References (9)

PMID Year Title