Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -2.700 0.000
atypical teratoid/rhabdoid tumor 1.300 0.004
nasopharyngeal carcinoma -1.900 0.000
chronic rhinosinusitis -2.635 0.021
facioscapulohumeral dystrophy 2.900 0.000

AA Sequence

MGCSSSALNKAGDSSRFPSVTSNEHFSTAEESESCFAQPKPHALGRESTVDGNVQRESRPPLQKLKVSAE      1 - 70
PTANGVKPLQEQPLAKDVAPGRDATDQSGSTEKTQPGEGLEESGPPQPGGKEDAPAAEGKKKDAGAGTEA     71 - 140
ESLKGNAEAQPLGPEAKGQPLQAAVEKDSLRAVEVTENPQTAAEMKPLGTTENVLTLQIAGELQPQGTVG    141 - 210
KDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEKP    211 - 280
VMNDPFHKTPEGPGNMEQIQPEGIVGSMEHPARNVEAGAYVEMIRNIHTNEEDQRIEGETGEKVETDMEN    281 - 350
EKVSEGAETKEEETGEVVDLSAAT                                                  351 - 374
//

Text Mined References (5)

PMID Year Title
20208534 2010 Common variants at 5q22 associate with pediatric eosinophilic esophagitis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.