Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Esophagitis 35 0.0 0.9

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.300 4.2e-03
chronic rhinosinusitis -1.983 1.4e-02
facioscapulohumeral dystrophy 2.900 7.2e-05
interstitial cystitis -1.400 2.3e-03
nasopharyngeal carcinoma -1.900 1.1e-05

AA Sequence

MGCSSSALNKAGDSSRFPSVTSNEHFSTAEESESCFAQPKPHALGRESTVDGNVQRESRPPLQKLKVSAE      1 - 70
PTANGVKPLQEQPLAKDVAPGRDATDQSGSTEKTQPGEGLEESGPPQPGGKEDAPAAEGKKKDAGAGTEA     71 - 140
ESLKGNAEAQPLGPEAKGQPLQAAVEKDSLRAVEVTENPQTAAEMKPLGTTENVLTLQIAGELQPQGTVG    141 - 210
KDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEKP    211 - 280
VMNDPFHKTPEGPGNMEQIQPEGIVGSMEHPARNVEAGAYVEMIRNIHTNEEDQRIEGETGEKVETDMEN    281 - 350
EKVSEGAETKEEETGEVVDLSAAT                                                  351 - 374
//

Text Mined References (5)

PMID Year Title