Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.12
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
uncontrolled asthma 1.100 0.006
osteosarcoma -2.129 0.043
glioblastoma 1.600 0.004
non-small cell lung cancer -1.662 0.000
pediatric high grade glioma 1.500 0.000
pilocytic astrocytoma 1.300 0.000
Breast cancer -3.500 0.000
lung carcinoma -2.200 0.000
ulcerative colitis 1.800 0.001
ovarian cancer -2.100 0.000

AA Sequence

MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTN      1 - 70
GYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSLFNLSTSKSWLHGSIFGDINS     71 - 140
SPSEDNWLKGTRRLDTDHCNGNADDLDCSSLTDDWESGKMNAESVITSSSSHIISQPPGGNSHSLSLQSQ    141 - 210
LTASERFQENSSDHSETRLLQEVFFQAILLAVCLIISACARWFMGEILASVFTCSLMITVAYVKSLFLSL    211 - 280
ASYFKTTACARFVKI                                                           281 - 295
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.