Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.12
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.400 1.0e-03
Astrocytoma, Pilocytic 1.300 4.1e-05
Breast cancer -3.500 2.1e-18
glioblastoma 1.400 1.6e-03
lung carcinoma -2.200 3.3e-20
non-small cell lung cancer -1.662 6.0e-17
osteosarcoma -2.129 4.3e-02
ovarian cancer -2.100 2.0e-06
ulcerative colitis 1.800 5.1e-04
uncontrolled asthma 1.100 6.0e-03

AA Sequence

MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTN      1 - 70
GYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSLFNLSTSKSWLHGSIFGDINS     71 - 140
SPSEDNWLKGTRRLDTDHCNGNADDLDCSSLTDDWESGKMNAESVITSSSSHIISQPPGGNSHSLSLQSQ    141 - 210
LTASERFQENSSDHSETRLLQEVFFQAILLAVCLIISACARWFMGEILASVFTCSLMITVAYVKSLFLSL    211 - 280
ASYFKTTACARFVKI                                                           281 - 295
//

Text Mined References (3)

PMID Year Title