Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.519 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.700 0.000
adrenocortical carcinoma -1.281 0.002
pediatric high grade glioma -1.200 0.000
invasive ductal carcinoma -1.100 0.015

Synonym

Accession Q6P5X5 A8MTW6 D3DX18 F5H3A8 J3KNP9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MCRCSLVLLSVDHEVPFSSFFIGWRTEGRAWRAGRPDMADGSGWQPPRPCEAYRAEWKLCRSARHFLHHY      1 - 70
YVHGERPACEQWQRDLASCRDWEERRNAEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEK     71 - 140
DE                                                                        141 - 142
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.