Property Summary

NCBI Gene PubMed Count 57
PubMed Score 112.24
PubTator Score 81.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dermatitis 157 3.255 1.6

Expression

  Differential Expression (15)

Disease log2 FC p
pancreatic cancer 1.200 3.3e-04
Breast cancer 1.200 5.9e-05
colon cancer 1.300 1.8e-02
esophageal adenocarcinoma 1.200 3.1e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
invasive ductal carcinoma 2.400 6.2e-04
lung adenocarcinoma 1.300 3.6e-08
lung cancer 1.500 1.7e-04
medulloblastoma, large-cell 1.300 1.1e-02
nephrosclerosis -1.127 6.8e-03
non-small cell lung cancer 1.265 1.9e-12
ovarian cancer 2.300 1.9e-08
pancreatic ductal adenocarcinoma liver m... 1.322 1.2e-02
tuberculosis 1.800 2.3e-09
ulcerative colitis -1.200 3.4e-05

Gene RIF (34)

AA Sequence

MASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCANGPCGKCLSVED      1 - 70
ALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCEDARAGLWASHADHLLALLESPKALTPGL     71 - 140
SWLLQRMQARAAGQTPKMACVDIPQLLEEAVGAGAPGSAGGVLAALLDHVRSGSCFHALPSPQYFVDFVF    141 - 210
QQHSSEVPMTLAELSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSARDVMAAY    211 - 280
GLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLSQSERYLYGSLATLLICLCAVFGLLLLTC    281 - 350
TGCRGVTHYILQTFLSLAVGAVTGDAVLHLTPKVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLF    351 - 420
NLLLPRDPEDLEDGPCGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPELLNPEPRRLS    421 - 490
PELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALL    491 - 560
LNLASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPWLLFLLHNVGLLG    561 - 630
GWTVLLLLSLYEDDITF                                                         631 - 647
//

Text Mined References (58)

PMID Year Title