Property Summary

NCBI Gene PubMed Count 54
Grant Count 29
R01 Count 26
Funding $2,822,801.99
PubMed Score 104.16
PubTator Score 81.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (31)

PMID Text
26305676 Data sho that silencing of zinc transporter ZIP4 resulted in increased bone tissue mineral density, and restoration of bone strength.
25971965 Developed is a structural model of ZIP4 by combining protein prediction methods with in situ experiments. Insight into the permeation pathway of ZIP4 is provided.
25921144 In glioma tumors, high ZIP4 expression was significantly associated with higher grade.
25882556 Studied the zinc binding properties of the large intracellular loop of hZIP4.
25391167 SLC39A4 mutations have roles in zinc deficiency
24586184 Both acrodermatitis mutations cause absence of the ZIP4 transporter cell surface expression and nearly absent zinc uptake.
24553114 The results described a previously uncharacterized role of ZIP4 in apoptosis resistance and elucidated a novel pathway through which ZIP4 regulates pancreatic cancer growth.
23857777 ZIP4 activates the zinc-dependent transcription factor CREB and requires this transcription factor to increase miR-373 expression through the regulation of its promoter.
23595627 High ZIP4 expression is associated with glioma.
23331012 resulkts indicate ZIP4 is the only zinc transporter that is significantly up-regulated in pancreatic cancer and might be the major zinc transporter that plays an important role in pancreatic cancer growth
More...

AA Sequence

MASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCANGPCGKCLSVED      1 - 70
ALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCEDARAGLWASHADHLLALLESPKALTPGL     71 - 140
SWLLQRMQARAAGQTPKTACVDIPQLLEEAVGAGAPGSAGGVLAALLDHVRSGSCFHALPSPQYFVDFVF    141 - 210
QQHSSEVPMTLAELSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSARDVMAAY    211 - 280
GLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLSQSERYLYGSLATLLICLCAVFGLLLLTC    281 - 350
TGCRGVTHYILQTFLSLAVGALTGDAVLHLTPKVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLF    351 - 420
NLLLPRDPEDLEDGPCGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPELLNPEPRRLS    421 - 490
PELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALL    491 - 560
LNLASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPWLLFLLHNVGLLG    561 - 630
GWTVLLLLSLYEDDITF                                                         631 - 647
//

Text Mined References (55)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26305676 2015 ZIP4 silencing improves bone loss in pancreatic cancer.
25971965 2015 Computation and Functional Studies Provide a Model for the Structure of the Zinc Transporter hZIP4.
25921144 2015 Expression Profile Analysis of Zinc Transporters (ZIP4, ZIP9, ZIP11, ZnT9) in Gliomas and their Correlation with IDH1 Mutation Status.
25882556 2015 The large intracellular loop of hZIP4 is an intrinsically disordered zinc binding domain.
25391167 2014 SLC39A4 mutation in zinc deficiency patients.
24586184 2014 Extreme population differences in the human zinc transporter ZIP4 (SLC39A4) are explained by positive selection in Sub-Saharan Africa.
24553114 2014 ZIP4 confers resistance to zinc deficiency-induced apoptosis in pancreatic cancer.
23857777 2013 A novel epigenetic CREB-miR-373 axis mediates ZIP4-induced pancreatic cancer growth.
23595627 2013 ZIP4 is a novel molecular marker for glioma.
More...