Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.72
PubTator Score 9.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MGWLRPGPRPLCPPARASWAFSHRFPSPLAPRRSPTPFFMASLLCCGPKLAACGIVLSAWGVIMLIMLGI      1 - 70
FFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR        71 - 137
//

Text Mined References (15)

PMID Year Title