Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.12
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.941 1.1e-07
astrocytoma 1.200 1.3e-12
Astrocytoma, Pilocytic 1.200 9.3e-05
atypical teratoid/rhabdoid tumor 1.300 1.5e-05
diabetes mellitus -1.600 1.8e-02
Duchenne muscular dystrophy 1.135 9.9e-08
glioblastoma 1.200 3.9e-04
Hydrolethalus syndrome -1.078 3.4e-02
juvenile dermatomyositis 1.493 2.5e-12
medulloblastoma, large-cell 1.400 1.4e-02
non-small cell lung cancer 1.063 2.2e-11
oligodendroglioma 1.600 1.4e-12
pancreatic ductal adenocarcinoma liver m... -1.929 2.4e-02
posterior fossa group A ependymoma 1.200 5.2e-06
psoriasis 1.200 6.0e-49
sonic hedgehog group medulloblastoma 1.300 4.0e-04
ulcerative colitis 1.500 2.3e-06

Protein-protein Interaction (4)

Gene RIF (1)

AA Sequence

MAPQKDRKPKRSTWRFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKNKITVVSEK      1 - 70
QFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESESED                       71 - 122
//

Text Mined References (12)

PMID Year Title