Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.95
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Nemaline myopathy 17 4.16 2.1
Cardiomyopathy 110 3.177 1.6

Expression

Synonym

Accession Q6P5Q4 A4D0W9 A4D0Y2 Q8WVJ8
Symbols CLMOD
C-LMOD

Gene

PDB

4RWT  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
26873245 The mutation reduced binding affinity for both Lmod2 and Tmod1. The effect of the K15N mutation on Tpm1.1 binding to Lmod2 and Tmod1 provides a molecular rationale for the development of familial dilated cardiomyopathies .
26417072 Complementary functional studies suggest that the binding of Lmod2 stimulates ATP hydrolysis and accelerates actin nucleation and polymerization.
26370058 The C-terminal extension of Lmod2 and C terminal of Tmod1 are sufficient to produce a filament nucleator.
18403713 study describes an actin-binding protein, leiomodin, that acted as a strong filament nucleator in muscle cells
16633140 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALM      1 - 70
AYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEEEEEESQEEEEEEDSDEEERT     71 - 140
IETAKGINGTVNYDSVNSDNSKPKIFKSQIENINLTNGSNGRNTESPAAIHPCGNPTVIEDALDKIKSND    141 - 210
PDTTEVNLNNIENITTQTLTRFAEALKDNTVVKTFSLANTHADDSAAMAIAEMLKVNEHITNVNVESNFI    211 - 280
TGKGILAIMRALQHNTVLTELRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTR    281 - 350
NMDKQRQKRLQEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVAT    351 - 420
PPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQKKKKGKKVKKQPN    421 - 490
SILKEIKNSLRSVQEKKMEDSSRPSTPQRSAHENLMEAIRGSSIKQLKRVEVPEALR                 491 - 547
//

Text Mined References (12)

PMID Year Title
26873245 2016 Localization of the binding interface between leiomodin-2 and ?-tropomyosin.
26417072 2015 Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
26370058 2015 How Leiomodin and Tropomodulin use a common fold for different actin assembly functions.
25250574 2014 Leiomodin-3 dysfunction results in thin filament disorganization and nemaline myopathy.
20685966 2010 Different localizations and cellular behaviors of leiomodin and tropomodulin in mature cardiomyocyte sarcomeres.
18403713 2008 Leiomodin is an actin filament nucleator in muscle cells.
16633140 2006 Risperidone-related weight gain: genetic and nongenetic predictors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...