Property Summary

NCBI Gene PubMed Count 31
PubMed Score 59.50
PubTator Score 18.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
hepatocellular carcinoma 547 8.3e-06
osteosarcoma 7950 1.1e-05
pancreatic cancer 2398 2.5e-03
pancreatic carcinoma 562 2.5e-03

Expression

  Differential Expression (4)

Disease log2 FC p
hepatocellular carcinoma 1.600 8.3e-06
osteosarcoma -2.544 1.1e-05
pancreatic cancer 1.300 2.5e-03
pancreatic carcinoma 1.300 2.5e-03

Synonym

Accession Q6P589 Q6I9Y0 Q9H2H7 Q9H5G2 TIPE2
Symbols TIPE2

PDB

3F4M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (27)

AA Sequence

MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKV      1 - 70
AVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSH     71 - 140
GRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL                              141 - 184
//

Text Mined References (37)

PMID Year Title