Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
R01 Count 5
Funding $383,630.2
PubMed Score 47.96
PubTator Score 18.36

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (16)

PMID Text
26530498 The TIPE2-elicited antimetastatic effect in gastric cancer was closely associated with the inhibition of AKT signaling and enhancement of GSK3b activity followed by the degradation and decreased translocation to nucleus of b-catenin
26426653 TIPE2 mRNA showed sensitivity of 74.63%, specificity of 90.24%, positive predictive value of 92.5%, and negative predictive value of 67.3% for predicting 3-month mortality in Acute-on-Chronic Hepatitis B Liver Failure.
25946186 TIPE2 promoted lung cancer cell apoptosis through affecting apoptosis-related molecules caspase-3, caspase-9, Bcl-2 and Bax, possibly via regulating P38 and Akt pathways.
25542151 TIPE2 might serve as a tumor suppressor in non-small cell lung cancer progression.
25536447 Tumor necrosis factor-alpha-induced protein-8 like-2 (TIPE2) upregulates p27 to decrease gastic cancer cell proliferation
25499447 TIPE2 plays an important role in regulating hepatitis B virus-specific CD8(+) T cell functions in patients with hepatitis B.
25339267 Both TNF-alpha and TIPE2 might be potential targets for the treatment of hepatocellular carcinoma metastasis.
24934366 TIPE2 can inhibit caspase-8 activity in colon cancer cells. TIPE2 can regulate TLR4 inflammatory effect and inhibit further amplification of cascade reaction via caspase-8.
24806446 These results strongly suggest that TIPE2 plays an important role in shifting L-arginase metabolism from production of NO to urea, during host inflammatory response.
24274578 Human TIPE2 is an endogenous inhibitor of Rac1 in hepatocellular carcinoma (HCC) by which it attenuates invasion and metastasis of HCC.
More...

AA Sequence

MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKV      1 - 70
AVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSH     71 - 140
GRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL                              141 - 184
//

Text Mined References (25)

PMID Year Title
26530498 2016 TIPE2 functions as a metastasis suppressor via negatively regulating ?-catenin through activating GSK3? in gastric cancer.
26426653 2015 TIPE2 mRNA Level in PBMCs Serves as a Novel Biomarker for Predicting Short-Term Mortality of Acute-on-Chronic Hepatitis B Liver Failure: A Prospective Single-Center Study.
25946186 2015 TIPE2 Inhibits Lung Cancer Growth Attributing to Promotion of Apoptosis by Regulating Some Apoptotic Molecules Expression.
25542151 2015 Downregulated TIPE2 is associated with poor prognosis and promotes cell proliferation in non-small cell lung cancer.
25536447 2015 Tumor necrosis factor-?-induced protein-8 like-2 (TIPE2) upregulates p27 to decrease gastic cancer cell proliferation.
25499447 2015 TIPE2 protein negatively regulates HBV-specific CD8? T lymphocyte functions in humans.
25339267 2015 TIPE2 inhibits TNF-?-induced hepatocellular carcinoma cell metastasis via Erk1/2 downregulation and NF-?B activation.
24934366 2014 A novel inflammatory regulator TIPE2 inhibits TLR4-mediated development of colon cancer via caspase-8.
24806446 2014 TIPE2 negatively regulates inflammation by switching arginine metabolism from nitric oxide synthase to arginase.
24274578 2013 Human tumor necrosis factor (TNF)-alpha-induced protein 8-like 2 suppresses hepatocellular carcinoma metastasis through inhibiting Rac1.
More...