Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.21
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q6P587 B1AK40 B1AK41 Q6FIC7 Q96RY1 Q9H0N6
Symbols YISKL
C16orf36

Gene

PANTHER Protein Class (1)

PDB

1SAW  

Gene RIF (5)

PMID Text
26266933 we recently identified human FAH domain containing protein-1 (FAHD1) as the first eukaryotic oxaloacetate decarboxylase..these data establish a role of fahd-1 to maintain mitochondrial function and consequently physical activity
25575590 Based on molecular modeling and subsequent biochemical investigations, the study identified FAHD1 as a eukaryotic oxaloacetate decarboxylase enzyme.
21878618 identified mammalian FAHD1 as a novel mitochondrial enzyme with acylpyruvate hydrolase activity.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHH      1 - 70
ELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKI     71 - 140
PDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIH    141 - 210
GLVSMTFKVEKPEY                                                            211 - 224
//

Text Mined References (20)

PMID Year Title
26266933 2015 FAH domain containing protein 1 (FAHD-1) is required for mitochondrial function and locomotion activity in C. elegans.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25575590 2015 Identification of FAH domain-containing protein 1 (FAHD1) as oxaloacetate decarboxylase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21878618 2011 Identification of human fumarylacetoacetate hydrolase domain-containing protein 1 (FAHD1) as a novel mitochondrial acylpyruvase.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16381901 2006 The LIFEdb database in 2006.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...