Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (3)

PMID Text
20861304 Data show that depletion of GCP8 specifically affects the organization of the interphase microtubule network.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPL      1 - 70
AVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSA     71 - 140
TRLPKGGGPGKSPTQGST                                                        141 - 158
//

Text Mined References (10)

PMID Year Title
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20861304 2010 The gammaTuRC revisited: a comparative analysis of interphase and mitotic human gammaTuRC redefines the set of core components and identifies the novel subunit GCP8.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.