Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6P575
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTAAETGRGKPRLGGGSGLGGSPAAVVWLHVGATGRDAVSPREPVVAAQAAGRPLKLPRRLLRQPTPGLR      1 - 70
GAESGPTVDMPVPSSFNDIGQGWRLRHFVSWLWYEREVTLLERWIQDLCTRVVLRIGSAHFYAIVWVNGV     71 - 140
DTVEHEGGYLPFEADISSLFQVEPLPSHLCITIAINNTLTPQPCHQGPSVHDRHLQVGTILPPLHAPTFP    141 - 210
PHPVVFLPGTGYPKGYFVQNTDFDFFSYAGLLWSLLLYTTPPTYIDDVTVTTGVKRDSGEGFW           211 - 273
//

Text Mined References (5)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
8678981 1996 Composite exon structure of an unusual Ig lambda-like gene located at human 22q11 position.
2511029 1989 Isolation of early immunoglobulin lambda-like gene transcripts in human fetal liver.