Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.02
PubTator Score 1.98

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.200 2.5e-02
ductal carcinoma in situ 1.100 1.7e-02
interstitial cystitis -2.400 1.3e-03
nasopharyngeal carcinoma -1.400 3.3e-05
spina bifida -2.327 2.6e-02
ulcerative colitis -1.100 2.2e-03

Gene RIF (1)

AA Sequence

MERAEEPVVYQKLLPWEPSLESEEEVEEEETSEALVLNPRRHQDSSRNKAGGLPGTWARVVAALLLLAVG      1 - 70
CSLAVRQLQNQGRSTGSLGSVAPPPGGHSHGPGVYHHGAIISPAGRELLVAGGNVVDAGVGAALCLAVVH     71 - 140
PHATGLGAMFWGLFHDSSSGNSTALTSGPAQTLAPGLGLPAALPTLHLLHARFGRLPWPRLLVGPTTLAQ    141 - 210
EGFLVDTPLARALVARGTEGLCPLLCHADGTPLGAGARATNPQLAAVLRSAALAPTSDLAGDALLSLLAG    211 - 280
DLGVEVPSAVPRPTLEPAEQLPVPQGILFTTPSPSAGPELLALLEAALRSGAPIPDPCPPFLQTAVSPES    281 - 350
SALAAVDSSGSVLLLTSSLNCSFGSAHLSPSTGVLLSNLVAKSTTSAWACPLILRGSLDDTEADVLGLVA    351 - 420
SGTPDVARAMTHTLLRHLAARPPTQAQHQHQGQQEPTEHPSTCGQGTLLQVAAHTEHAHVSSVPHACCPF    421 - 490
QGF                                                                       491 - 493
//

Text Mined References (11)

PMID Year Title