Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.02
PubTator Score 1.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.200 0.025
interstitial cystitis -3.300 0.000
nasopharyngeal carcinoma -1.400 0.000
spina bifida -2.327 0.026
ductal carcinoma in situ 1.100 0.017
ulcerative colitis -1.100 0.002

Synonym

Accession Q6P531 B4DUH4 Q8NCM0 GGT 6
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MERAEEPVVYQKLLPWEPSLESEEEVEEEETSEALVLNPRRHQDSSRNKAGGLPGTWARVVAALLLLAVG      1 - 70
CSLAVRQLQNQGRSTGSLGSVAPPPGGHSHGPGVYHHGAIISPAGRELLVAGGNVVDAGVGAALCLAVVH     71 - 140
PHATGLGAMFWGLFHDSSSGNSTALTSGPAQTLAPGLGLPAALPTLHLLHARFGRLPWPRLLVGPTTLAQ    141 - 210
EGFLVDTPLARALVARGTEGLCPLLCHADGTPLGAGARATNPQLAAVLRSAALAPTSDLAGDALLSLLAG    211 - 280
DLGVEVPSAVPRPTLEPAEQLPVPQGILFTTPSPSAGPELLALLEAALRSGAPIPDPCPPFLQTAVSPES    281 - 350
SALAAVDSSGSVLLLTSSLNCSFGSAHLSPSTGVLLSNLVAKSTTSAWACPLILRGSLDDTEADVLGLVA    351 - 420
SGTPDVARAMTHTLLRHLAARPPTQAQHQHQGQQEPTEHPSTCGQGTLLQVAAHTEHAHVSSVPHACCPF    421 - 490
QGF                                                                       491 - 493
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
18357469 2008 The human gamma-glutamyltransferase gene family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.