Property Summary

NCBI Gene PubMed Count 24
PubMed Score 16.46
PubTator Score 13.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
fibroadenoma 1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.300 3.4e-04
invasive ductal carcinoma 1.200 4.9e-03
psoriasis 1.300 1.4e-73
ulcerative colitis -1.100 1.0e-03

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (14)

AA Sequence

MAPVGGGGRPVGGPARGRLLLAAPVLLVLLWALGARGQGSPQQGTIVGMRLASCNKSCGTNPDGIIFVSE      1 - 70
GSTVNLRLYGYSLGNISSNLISFTEVDDAETLHKSTSCLELTKDLVVQQLVNVSRGNTSGVLVVLTKFLR     71 - 140
RSESMKLYALCTRAQPDGPWLKWTDKDSLLFMVEEPGRFLPLWLHILLITVLLVLSGIFSGLNLGLMALD    141 - 210
PMELRIVQNCGTEKERRYARKIEPIRRKGNYLLCSLLLGNVLVNTSLTILLDNLIGSGLMAVASSTIGIV    211 - 280
IFGEILPQALCSRHGLAVGANTILLTKFFMLLTFPLSFPISKLLDFFLGQEIRTVYNREKLMEMLKVTEP    281 - 350
YNDLVKEELNMIQGALELRTKTVEDIMTQLQDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVD    351 - 420
ILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNNEGEGDPFYEV    421 - 490
LGLVTLEDVIEEIIKSEILDESDMYTDNRSRKRVSEKNKRDFSAFKDADNELKVKISPQLLLAAHRFLAT    491 - 560
EVSQFSPSLISEKILLRLLKYPDVIQELKFDEHNKYYARHYLYTRNKPADYFILILQGKVEVEAGKENMK    561 - 630
FETGAFSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSV    631 - 700
RALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKAS    701 - 770
HENAI                                                                     771 - 775
//

Text Mined References (29)

PMID Year Title