Property Summary

NCBI Gene PubMed Count 10
PubMed Score 19.39
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Galloway Mowat syndrome 6 0.0 0.0
Disease Target Count P-value
ependymoma 4679 2.0e-08
psoriasis 6694 1.9e-04
group 3 medulloblastoma 4104 7.2e-04
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Microcephaly 166 4.336 2.2
Nephrotic Syndrome 78 3.767 1.9
Optic Atrophy 242 3.171 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.100 2.0e-08
group 3 medulloblastoma 1.200 7.2e-04
psoriasis 1.400 1.9e-04

Synonym

Accession Q6P4I2 Q96JZ1 Q9P0B7
Symbols GAMOS
GAMOS1
HSPC264

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNEILHLKLPLRLSVKENKGLFP      1 - 70
ERDFKVRHGGFSDRSIFDLKHVPHTRLLVTSGLPGCYLQVWQVAEDSDVIKAVSTIAVHEKEESLWPRVA     71 - 140
VFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWA    141 - 210
PLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLR    211 - 280
VTWAPGLKNCLAISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWH    281 - 350
PCRPRTLLSATNDASLHVWDWVDLCAPR                                              351 - 378
//

Text Mined References (12)

PMID Year Title