Property Summary

NCBI Gene PubMed Count 10
PubMed Score 15.51
PubTator Score 7.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 2.2e-18
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Tooth disease 4 0.0 2.0
Disease Target Count Z-score Confidence
Rectum adenocarcinoma 8 3.219 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 2.2e-18

Gene RIF (2)

AA Sequence

MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPF      1 - 70
VPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAK     71 - 140
FYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYD    141 - 210
ASTFRGREKRPCTSMHFQLPIQA                                                   211 - 233
//

Text Mined References (13)

PMID Year Title