Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $19,887
PubMed Score 14.86
PubTator Score 7.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 0.000

Gene RIF (2)

PMID Text
21802380 Genetic alteration of JS-2 was found to be related to location, pathological subtypes and staging of colorectal cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPF      1 - 70
VPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAK     71 - 140
FYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYD    141 - 210
ASTFRGREKRPCTSMHFQLPIQA                                                   211 - 233
//

Text Mined References (13)

PMID Year Title
22956598 2013 Genome-wide association study meta-analysis of chronic widespread pain: evidence for involvement of the 5p15.2 region.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21802380 2011 Altered JS-2 expression in colorectal cancers and its clinical pathological relevance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16328025 2006 Transforming capacity of two novel genes JS-1 and JS-2 located in chromosome 5p and their overexpression in human esophageal squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...