Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.86
PubTator Score 7.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.20726731978335E-18
Disease Target Count Z-score Confidence
Tooth disease 4 0.0 1.0
Disease Target Count Z-score Confidence
Rectum adenocarcinoma 5 3.281 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.100 0.000

Synonym

Accession Q6P4H8 B4DT41 B4DXK2 E9PBZ4
Symbols JS-2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
21802380 Genetic alteration of JS-2 was found to be related to location, pathological subtypes and staging of colorectal cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPF      1 - 70
VPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAK     71 - 140
FYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYD    141 - 210
ASTFRGREKRPCTSMHFQLPIQA                                                   211 - 233
//

Text Mined References (13)

PMID Year Title
22956598 2013 Genome-wide association study meta-analysis of chronic widespread pain: evidence for involvement of the 5p15.2 region.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21802380 2011 Altered JS-2 expression in colorectal cancers and its clinical pathological relevance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19416867 2009 The transcriptome of human CD34+ hematopoietic stem-progenitor cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16328025 2006 Transforming capacity of two novel genes JS-1 and JS-2 located in chromosome 5p and their overexpression in human esophageal squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...