Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.96
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
group 3 medulloblastoma 2.000 1.5e-04
lung adenocarcinoma 1.100 7.2e-07
lung cancer 1.600 1.6e-04
malignant mesothelioma 1.400 3.4e-06
medulloblastoma, large-cell 1.600 1.5e-04
non-small cell lung carcinoma 1.400 1.3e-17
osteosarcoma -1.845 1.8e-03
primitive neuroectodermal tumor 1.200 3.3e-03
psoriasis 1.300 4.3e-77

Gene RIF (1)

AA Sequence

MWDQRLVRLALLQHLRAFYGIKVKGVRGQCDRRRHETAATEIGGKIFGVPFNALPHSAVPEYGHIPSFLV      1 - 70
DACTSLEDHIHTEGLFRKSGSVIRLKALKNKVDHGEGCLSSAPPCDIAGLLKQFFRELPEPILPADLHEA     71 - 140
LLKAQQLGTEEKNKATLLLSCLLADHTVHVLRYFFNFLRNVSLRSSENKMDSSNLAVIFAPNLLQTSEGH    141 - 210
EKMSSNTEKKLRLQAAVVQTLIDYASDIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKR    211 - 280
KRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRTLPVDSSHGFSSKKRKSIKHNF    281 - 350
NFELLPSNLFNSSSTPVSVHIDTSSEGSSQSSLSPVLIGGNHLITAGVPRRSKRIAGKKVCRVESGKAGC    351 - 420
FSPKISHKEKVRRSLRLKFNLGKNGREVNGCSGVNRYESVGWRLANQQSLKNRIESVKTGLLFSPDVDEK    421 - 490
LPKKGSEKISKSEETLLTPERLVGTNYRMSWTGPNNSSFQEVDANEASSMVENLEVENSLEPDIMVEKSP    491 - 560
ATSCELTPSNLNNKHNSNITSSPLSGDENNMTKETLVKVQKAFSESGSNLHALMNQRQSSVTNVGKVKLT    561 - 630
EPSYLEDSPEENLFETNDLTIVESKEKYEHHTGKGEKCFSERDFSPLQTQTFNRETTIKCYSTQMKMEHE    631 - 700
KDIHSNMPKDYLSKQEFSSDEEIKKQQSPKDKLNNKLKENENMMEGNLPKCAAHSKDEARSSFSQQSTCV    701 - 770
VTNLSKPRPMRIAKQQSLETCEKTVSESSQMTEHRKVSDHIQWFNKLSLNEPNRIKVKSPLKFQRTPVRQ    771 - 840
SVRRINSLLEYSRQPTGHKLASLGDTASPLVKSVSCDGALSSCIESASKDSSVSCIKSGPKEQKSMSCEE    841 - 910
SNIGAISKSSMELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKVPLDDLTNHDIVKPVVNNNMG    911 - 980
ISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKPVDL                               981 - 1023
//

Text Mined References (21)

PMID Year Title