Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.89
PubTator Score 3.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q6P4F2 Q8N8B8
Symbols FDX2

Gene

PDB

2Y5C  

Gene RIF (3)

PMID Text
24281368 Fdx2 is the second component of the Fe-S cluster biogenesis machinery, the first being IscU that is associated with isolated mitochondrial myopathy.
23208207 unique conformational change is observed when holo hFd2 is warmed to physiological temperatures, or higher
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEEDAGGPERPGDVVNV      1 - 70
VFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMA     71 - 140
PLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH                               141 - 183
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24281368 2014 Deleterious mutation in FDX1L gene is associated with a novel mitochondrial muscle myopathy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23208207 2013 Human ferredoxin-2 displays a unique conformational change.
22101253 2012 Both human ferredoxins 1 and 2 and ferredoxin reductase are important for iron-sulfur cluster biogenesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20547883 2010 Humans possess two mitochondrial ferredoxins, Fdx1 and Fdx2, with distinct roles in steroidogenesis, heme, and Fe/S cluster biosynthesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...