Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.83
PubTator Score 3.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (3)

AA Sequence

MAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEEDAGGPERPGDVVNV      1 - 70
VFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMA     71 - 140
PLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH                               141 - 183
//

Text Mined References (12)

PMID Year Title