Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.81
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 6.92532148894003E-6
medulloblastoma, large-cell 6234 2.54917157509804E-4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.633 0.000
medulloblastoma, large-cell 1.200 0.000

Synonym

Accession Q6P4F1 A8KAC8 Q70GG3 Q8IVI6 Q8IVI7 Q8IVJ3 Q8TE43 Q9BSR3
Symbols FUCTX

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19088067 Activity, splice variants, conserved peptide motifs, and phylogeny of two new alpha1,3-fucosyltransferase families (FUT10 and FUT11).
12370785 amino acid sequence

AA Sequence

MVRIQRRKLLASCLCVTATVFLLVTLQVMVELGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTF      1 - 70
NRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGTDFNIDSLPLPRKA     71 - 140
HHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLPLTTQYLESIEVLKSLRYLVPLQSKNKLRKR    141 - 210
LAPLVYVQSDCDPPSDRDSYVRELMTYIEVDSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAF    211 - 280
ENAVCDDYITEKFWRPLKLGVVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAY    281 - 350
VEWKLKGEISNQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSC    351 - 420
PEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD               421 - 479
//

Text Mined References (7)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19088067 2009 Activity, splice variants, conserved peptide motifs, and phylogeny of two new alpha1,3-fucosyltransferase families (FUT10 and FUT11).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370785 2002 Comparison of human and mouse Fuc-TX and Fuc-TXI genes, and expression studies in the mouse.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.