Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.29
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.200 5.9e-03
ependymoma 1.400 2.7e-03
intraductal papillary-mucinous adenoma (... 1.300 5.3e-04
intraductal papillary-mucinous carcinoma... 1.100 1.8e-02
medulloblastoma, large-cell -1.400 4.6e-03
oligodendroglioma 1.300 5.5e-03
osteosarcoma 1.217 1.7e-06
ovarian cancer -1.700 1.6e-09

Gene RIF (2)

AA Sequence

MVGFGANRRAGRLPSLVLVVLLVVIVVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDL      1 - 70
LLLVDTHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQ     71 - 140
EDQLQDYRKNNTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINN    141 - 210
QVVPKNIPKVAENVADKNEEPSSNHIPHGKEQIKRGGDAGMPGIEENDLAKVDDLPPALRKPPISVSQHE    211 - 280
SHQAISHLPTGQPLSPNMPPDSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVS    281 - 350
DFHKLKQSRFFDENESPVDPQHGSKLADYNGDDGNVGEYEADKQAELAYNEEEDGDGGEEDVQGERGPGL    351 - 420
HAITMKPTSKFFG                                                             421 - 433
//

Text Mined References (17)

PMID Year Title