Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.28841105028221E-6
posterior fossa group B ependymoma 1530 1.02207729449553E-5
tuberculosis 1563 1.98488431963595E-5
atypical teratoid / rhabdoid tumor 4369 0.0141694636018994
Disease Target Count Z-score Confidence
Premature ovarian failure 64 4.085 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.093 0.000
atypical teratoid / rhabdoid tumor 1.200 0.014
tuberculosis 1.400 0.000
posterior fossa group B ependymoma 1.700 0.000

Synonym

Accession Q6P4D5 F5H036 Q8WVK9
Symbols

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG Inparanoid

 Compartment GO Term (0)

AA Sequence

MAQEKMKLGFKSLPSSTTADGNILRRVNSAPLINGLGFNSQVLQADMLRIRTNRTTFRNRRSLLLPPPPF      1 - 70
HGSISRLHQIKQEEAMDLINRETMSEWKLQSEIQISHSWEEGLKLVKWHFNINQKRFSKAQPTCFLLILP     71 - 140
NCQKIMCIYFQLLLMETTAMLDLLVIRQLKSALSQTLLCHLLILVLICSSRQTFN                   141 - 195
//

Text Mined References (5)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.