Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.15
PubTator Score 0.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.100 8.8e-03
Astrocytoma, Pilocytic 1.400 1.1e-05
atypical teratoid / rhabdoid tumor 2.200 1.0e-03
cystic fibrosis 1.500 3.6e-04
diabetes mellitus -1.200 6.9e-03
facioscapulohumeral dystrophy 1.300 4.1e-02
glioblastoma 1.100 5.2e-03
interstitial cystitis -1.500 6.7e-04
intraductal papillary-mucinous adenoma (... 1.100 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.500 6.0e-03
lung adenocarcinoma -1.500 3.4e-07
lung cancer -2.800 1.4e-03
lung carcinoma -3.800 2.1e-31
mucosa-associated lymphoid tissue lympho... 4.059 4.7e-03
nasopharyngeal carcinoma -1.700 1.5e-07
non-small cell lung cancer -1.371 5.6e-13
osteosarcoma -2.104 4.9e-03
ovarian cancer -1.800 9.7e-04
posterior fossa group A ependymoma 1.200 2.9e-06
psoriasis 2.100 2.1e-11
subependymal giant cell astrocytoma 2.825 9.4e-03
tuberculosis 2.900 1.0e-07

Gene RIF (1)

AA Sequence

MTRGGPGGRPGLPQPPPLLLLLLLLPLLLVTAEPPKPAGVYYATAYWMPAEKTVQVKNVMDKNGDAYGFY      1 - 70
NNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFME     71 - 140
KQDKWTRKNIKEYKTDSFWRHTGYVMAQIDGLYVGAKKRAILEGTKPMTLFQIQFLNSVGDLLDLIPSLS    141 - 210
PTKNGSLKVFKRWDMGHCSALIKVLPGFENILFAHSSWYTYAAMLRIYKHWDFNVIDKDTSSSRLSFSSY    211 - 280
PGFLESLDDFYILSSGLILLQTTNSVFNKTLLKQVIPETLLSWQRVRVANMMADSGKRWADIFSKYNSGT    281 - 350
YNNQYMVLDLKKVKLNHSLDKGTLYIVEQIPTYVEYSEQTDVLRKGYWPSYNVPFHEKIYNWSGYPLLVQ    351 - 420
KLGLDYSYDLAPRAKIFRRDQGKVTDTASMKYIMRYNNYKKDPYSRGDPCNTICCREDLNSPNPSPGGCY    421 - 490
DTKVADIYLASQYTSYAISGPTVQGGLPVFRWDRFNKTLHQGMPEVYNFDFITMKPILKLDIK           491 - 553
//

Text Mined References (10)

PMID Year Title