Property Summary

NCBI Gene PubMed Count 0
PubMed Score 2.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Renal oncocytoma 22 3.428 1.7

AA Sequence

MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSILQLVQNLMH      1 - 70
GDEDEEPQSPRIQNIGEQGHVAVLGHSLGAYILTLDEEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHE     71 - 140
EEREGLAKICRLAIHSQYEDFVVDGFSGLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTMF    141 - 210
GSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALG    211 - 280
YVSSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDPALTLVAGLISNKPTDKLRALPLWLSLQYLGLD    281 - 350
GFVERIKHACQLSQWLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSAVGRE    351 - 420
RHSCDALNLWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAGMIS                         421 - 469
//

Text Mined References (2)

PMID Year Title