Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Renal oncocytoma 22 3.512 1.8
Osteoporosis 257 2.0

AA Sequence

MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSILQLVQNLMH      1 - 70
GDEDEEPQSPRIQNIGEQGHVAVLGHSLGAYILTLDEEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHE     71 - 140
EEREGLAKICRLAIHSQYEDFVVDGFSGLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTMF    141 - 210
GSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALG    211 - 280
YVSSSVLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDPALTLVAGLISNKPTDKLRALPLWLSLQYLGLD    281 - 350
GFVERIKHACQLSQWLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSAVGRE    351 - 420
RHSCDALNLWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAGMIS                         421 - 469
//

Text Mined References (4)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.