Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.03
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma 2.082 5.6e-04
adult high grade glioma 1.800 6.5e-05
Atopic dermatitis 1.200 4.3e-04
atypical teratoid / rhabdoid tumor 1.800 2.0e-06
Breast cancer 2.200 3.2e-11
breast carcinoma 1.100 5.1e-29
ductal carcinoma in situ 1.700 2.4e-03
glioblastoma 2.000 6.8e-08
group 3 medulloblastoma 2.800 6.1e-07
intraductal papillary-mucinous carcinoma... 2.200 2.9e-04
intraductal papillary-mucinous neoplasm ... 2.400 2.0e-03
invasive ductal carcinoma 1.900 1.0e-03
lung adenocarcinoma 1.100 3.0e-05
medulloblastoma, large-cell 2.100 7.1e-06
non-small cell lung cancer 1.831 2.6e-15
osteosarcoma -2.355 1.8e-03
ovarian cancer 1.700 2.4e-04
posterior fossa group A ependymoma 1.100 9.5e-07
primitive neuroectodermal tumor 2.200 1.2e-04
psoriasis 1.700 5.4e-13

AA Sequence

MSLILNILREMLEYFGVPVEQVLLIWENKDYGSTRSIVRIIGKMLPLEPCRRPNFELIPLLNSVDSDNCG      1 - 70
SMVPSFADILYVANDEEASYLRFRNSIWKNEEEKVEIFHPLRLVRDPLSPAVRQKETVKNDLPVNEAAIR     71 - 140
KIAALENELTFLRSQIAAIVEMQELKNSTNSSSFGLSDERISLGQLSSSRAAHLSVDPDQLPGSVLSPPP    141 - 210
PPPLPPQFSSLQPPCFPPVQPGSNNICDSDNPATEMSKQNPAANKTNYSHHSKSQRNKDIPNMLDVLKDM    211 - 280
NKVKLRAIERSPGGRPIHKRKRQNSHWDPVSLISHALKQKFAFQEDDSFEKENRSWESSPFSSPETSRFG    281 - 350
HHISQSEGQRTKEEMVNTKAVDQGISNTSLLNSRI                                       351 - 385
//

Text Mined References (10)

PMID Year Title