Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.03
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 5.13497075093859E-29
non-small cell lung cancer 2798 2.61976063773779E-15
psoriasis 6685 5.39334324215832E-13
Breast cancer 3099 3.15038759451758E-11
group 3 medulloblastoma 2254 6.12966857607386E-7
posterior fossa group A ependymoma 1511 9.54097591737919E-7
atypical teratoid / rhabdoid tumor 4369 2.04368364408607E-6
pediatric high grade glioma 2712 2.4255821452666E-6
medulloblastoma, large-cell 6234 7.14067284296435E-6
glioblastoma 5572 1.18665310079695E-5
lung adenocarcinoma 2714 2.98623974410039E-5
primitive neuroectodermal tumor 3031 1.17347037456002E-4
ovarian cancer 8492 2.42769856679217E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.88640496188037E-4
Atopic dermatitis 944 4.29781861060499E-4
adrenocortical carcinoma 1427 5.56871612803804E-4
invasive ductal carcinoma 2950 0.00104522292551838
osteosarcoma 7933 0.00184823355788798
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00203831449394745
ductal carcinoma in situ 1745 0.00243479915974975

Expression

Synonym

Accession Q6P444 A8K8D8 E1P585 Q5JWR7 Q6ZUE8 Q7L3U6 Q9BZ39
Symbols DUFD1
FAM54A

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

AA Sequence

MSLILNILREMLEYFGVPVEQVLLIWENKDYGSTRSIVRIIGKMLPLEPCRRPNFELIPLLNSVDSDNCG      1 - 70
SMVPSFADILYVANDEEASYLRFRNSIWKNEEEKVEIFHPLRLVRDPLSPAVRQKETVKNDLPVNEAAIR     71 - 140
KIAALENELTFLRSQIAAIVEMQELKNSTNSSSFGLSDERISLGQLSSSRAAHLSVDPDQLPGSVLSPPP    141 - 210
PPPLPPQFSSLQPPCFPPVQPGSNNICDSDNPATEMSKQNPAANKTNYSHHSKSQRNKDIPNMLDVLKDM    211 - 280
NKVKLRAIERSPGGRPIHKRKRQNSHWDPVSLISHALKQKFAFQEDDSFEKENRSWESSPFSSPETSRFG    281 - 350
HHISQSEGQRTKEEMVNTKAVDQGISNTSLLNSRI                                       351 - 385
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.