Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Endometrial cancer 311 0.0 0.5
Disease Target Count Z-score Confidence
Ullrich congenital muscular dystrophy 5 4.04 2.0

AA Sequence

MSRRAPGSRLSSGGTNYSRSWNDWQPRTDSASADPGNLKYSSSRDRGGSSSYGLQPSNSAVVSRQRHDDT      1 - 70
RVHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVTSPEFTSVQHGSRALATKDMRKSQERSMSYC     71 - 140
DESRLSNLLRRITREDDRD                                                       141 - 159
//

Text Mined References (1)

PMID Year Title