Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

AA Sequence

MSRRAPGSRLSSGGTNYSRSWNDWQPRTDSASADPGNLKYSSSRDRGGSSSYGLQPSNSAVVSRQRHDDT      1 - 70
RVHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVTSPEFTSVQHGSRALATKDMRKSQERSMSYC     71 - 140
DESRLSNLLRRITREDDRD                                                       141 - 159
//

Text Mined References (1)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).