Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.15
PubTator Score 4.51

Knowledge Summary

Patent (582)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 5.80719993155809E-9
medulloblastoma, large-cell 6234 4.25947385106888E-6
psoriasis 6685 7.56430300213409E-6
osteosarcoma 7933 1.06698962254785E-5
ovarian cancer 8492 2.26855879370709E-5
primitive neuroectodermal tumor 3031 9.52965424823642E-5
glioblastoma 5572 3.5966811243919E-4
group 4 medulloblastoma 1875 4.02160536478047E-4
atypical teratoid / rhabdoid tumor 4369 0.00114214106313444
adrenocortical carcinoma 1427 0.00279346565679723
pediatric high grade glioma 2712 0.00629514832508991
invasive ductal carcinoma 2950 0.00978140348615117
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0116700120891399
sarcoidosis 368 0.0144726071879798
Gaucher disease type 1 171 0.0157630963117231
ependymoma 2514 0.0208027876768142
Breast cancer 3099 0.0248609387717636
astrocytic glioma 2241 0.0349967845143383
oligodendroglioma 2849 0.0434356804191878

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.100 0.035
ependymoma 1.500 0.021
oligodendroglioma 1.100 0.043
psoriasis 1.100 0.000
osteosarcoma 3.180 0.000
group 4 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.700 0.001
glioblastoma 1.800 0.000
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 1.200 0.000
adrenocortical carcinoma 1.416 0.003
pancreatic ductal adenocarcinoma liver m... -1.286 0.012
non-small cell lung cancer 1.119 0.000
sarcoidosis 1.200 0.014
Breast cancer 2.600 0.025
pediatric high grade glioma 1.200 0.006
invasive ductal carcinoma 1.400 0.010
ovarian cancer 2.000 0.000
Gaucher disease type 1 -1.300 0.016

Synonym

Accession Q6P3W7 A8KAB5 Q96EF4 Q96ST4 Q9H7V5 Q9NVH3 Q9P2I7
Symbols CVAK104

Gene

  Ortholog (14)

 Collection (1)

Pathway (1)

Gene RIF (8)

PMID Text
25496667 Genome-wide shRNA screening identifies SCYL2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23047923 results suggest that SCYL2 serves as a regulatory factor for Vpu, reducing the extent of Vpu phosphorylation and consequently enhancing BST2-mediated viral restriction.
23047923 Genome-wide shRNA screening identifies SCYL2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23047923 Knockdown of SCY1-like 2 (SCYL2) by siRNA enhances HIV-1 release in transfected HeLa cells
19643732 Studies identify CVAK104 as a novel binding partner of Dishevelled (Dvl) and that CVAK104 also interacts with Fzd5.
17587408 CVAK104 is an evolutionarily conserved protein involved in SNARE sorting that is essential for normal embryonic development
16914521 Together, our data suggest a function for CVAK104 in clathrin-dependent pathways between the trans-Golgi network and the endosomal system.
15809293 CVAK104 binds ATP and functions in vitro as a poly-L-lysine-stimulated kinase that is capable of autophosphorylation and phosphorylating the beta2-adaptin subunit of AP2.

AA Sequence

MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKL      1 - 70
IDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPI     71 - 140
SPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQE    141 - 210
PKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSR    211 - 280
QLDQLSRLGSSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKS    281 - 350
QFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQ    351 - 420
EPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIP    421 - 490
RIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLG    491 - 560
ITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEHKTKLEQLHIMQEQQKSLDIGNQMN    561 - 630
VSEEMKVTNIGNQQIDKVFNNIGADLLTGSESENKEDGLQNKHKRASLTLEEKQKLAKEQEQAQKLKSQQ    631 - 700
PLKPQVHTPVATVKQTKDLTDTLMDNMSSLTSLSVSTPKSSASSTFTSVPSMGIGMMFSTPTDNTKRNLT    701 - 770
NGLNANMGFQTSGFNMPVNTNQNFYSSPSTVGVTKMTLGTPPTLPNFNALSVPPAGAKQTQQRPTDMSAL    771 - 840
NNLFGPQKPKVSMNQLSQQKPNQWLNQFVPPQGSPTMGSSVMGTQMNVIGQSAFGMQGNPFFNPQNFAQP    841 - 910
PTTMTNSSSASNDLKDLFG                                                       911 - 929
//

Text Mined References (17)

PMID Year Title
23341777 2013 Genome-wide association study identifies a novel susceptibility locus at 12q23.1 for lung squamous cell carcinoma in han chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23047923 2012 Interferon-induced SCYL2 limits release of HIV-1 by triggering PP2A-mediated dephosphorylation of the viral protein Vpu.
21269460 2011 Initial characterization of the human central proteome.
19643732 2009 A coated vesicle-associated kinase of 104 kDa (CVAK104) induces lysosomal degradation of frizzled 5 (Fzd5).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17587408 2007 CVAK104 is a novel regulator of clathrin-mediated SNARE sorting.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16914521 2006 Clathrin-dependent association of CVAK104 with endosomes and the trans-Golgi network.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
More...