Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.93
PubTator Score 4.51

Knowledge Summary

Patent (582)

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.416 2.8e-03
astrocytic glioma 1.100 3.5e-02
atypical teratoid / rhabdoid tumor 1.700 1.1e-03
Breast cancer 2.600 2.5e-02
ependymoma 1.500 2.1e-02
Gaucher disease type 1 -1.300 1.6e-02
glioblastoma 1.800 3.6e-04
group 4 medulloblastoma 2.000 4.0e-04
invasive ductal carcinoma 1.400 9.8e-03
medulloblastoma, large-cell 2.300 4.3e-06
non-small cell lung cancer 1.119 5.8e-09
oligodendroglioma 1.100 4.3e-02
osteosarcoma 3.180 1.1e-05
ovarian cancer 2.000 2.3e-05
pancreatic ductal adenocarcinoma liver m... -1.286 1.2e-02
pediatric high grade glioma 1.200 6.3e-03
primitive neuroectodermal tumor 1.200 9.5e-05
psoriasis 1.100 7.6e-06
sarcoidosis 1.200 1.4e-02

Gene RIF (8)

AA Sequence

MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKL      1 - 70
IDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPI     71 - 140
SPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQE    141 - 210
PKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSR    211 - 280
QLDQLSRLGSSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKS    281 - 350
QFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQ    351 - 420
EPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIP    421 - 490
RIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLG    491 - 560
ITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEHKTKLEQLHIMQEQQKSLDIGNQMN    561 - 630
VSEEMKVTNIGNQQIDKVFNNIGADLLTGSESENKEDGLQNKHKRASLTLEEKQKLAKEQEQAQKLKSQQ    631 - 700
PLKPQVHTPVATVKQTKDLTDTLMDNMSSLTSLSVSTPKSSASSTFTSVPSMGIGMMFSTPTDNTKRNLT    701 - 770
NGLNANMGFQTSGFNMPVNTNQNFYSSPSTVGVTKMTLGTPPTLPNFNALSVPPAGAKQTQQRPTDMSAL    771 - 840
NNLFGPQKPKVSMNQLSQQKPNQWLNQFVPPQGSPTMGSSVMGTQMNVIGQSAFGMQGNPFFNPQNFAQP    841 - 910
PTTMTNSSSASNDLKDLFG                                                       911 - 929
//

Text Mined References (17)

PMID Year Title