Property Summary

NCBI Gene PubMed Count 11
Grant Count 10
R01 Count 4
Funding $3,407,220.15
PubMed Score 66.19
PubTator Score 5.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.718 0.000
subependymal giant cell astrocytoma -1.279 0.028

Gene RIF (4)

PMID Text
25792601 SCF(JFK) as a bona fide E3 ligase for ING4 and unraveled the JFK-ING4-NF-kappaB axis as an important player in the development and progression of breast cancer
24063688 The findings of this study suggest that a haplotype of the FBXO42 gene might be associated with a higher susceptibility to PD.
21127074 Substrate phosphorylation and feedback regulation in JFK-promoted p53 destabilization.
19509332 JFK promotes p53 turnover through assembly of an SCF (Skp1-Cul1-F-box) complex, revealing a pathway for the control of p53 degradation and providing a link between the SCF complex and p53 regulation.

AA Sequence

MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKT      1 - 70
AALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCT     71 - 140
QSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEI    141 - 210
HTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSP    211 - 280
HPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQC    281 - 350
VVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP    351 - 420
SGSREGSLSPARGDGSPILNGGSLSPGTAAVGGSSLDSPVQAISPSTPSAPEGYDLKIGLSLAPRRGSLP    421 - 490
DQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTVGGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSL    491 - 560
EAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHSLPPIARRLGHHPPQSLN    561 - 630
VGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQN    631 - 700
VKYYPKTNALYFVRAKR                                                         701 - 717
//

Text Mined References (16)

PMID Year Title
25792601 2015 SCF(JFK) is a bona fide E3 ligase for ING4 and a potent promoter of the angiogenesis and metastasis of breast cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24063688 2013 Genetic analysis of the FBXO42 gene in Chinese Han patients with Parkinson's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21127074 2011 Substrate phosphorylation and feedback regulation in JFK-promoted p53 destabilization.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19509332 2009 JFK, a Kelch domain-containing F-box protein, links the SCF complex to p53 regulation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...