Property Summary

Ligand Count 1
NCBI Gene PubMed Count 6
PubMed Score 3.02
PubTator Score 2.00

Knowledge Summary

Patent (529)

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.200 4.2e-03
Breast cancer -1.200 9.8e-08
chronic rhinosinusitis -2.350 1.3e-02
ependymoma 4.300 4.9e-02
lung carcinoma -1.600 4.8e-06
medulloblastoma, large-cell -1.100 1.9e-03
nasopharyngeal carcinoma -1.900 4.8e-06
osteosarcoma -2.314 2.9e-11
ovarian cancer -1.800 3.2e-04
pituitary cancer -1.100 1.2e-03

Gene RIF (2)

AA Sequence

MDKYDVIKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIQEKEASKKEVILLEKMKHPNIVAFFNSF      1 - 70
QENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIHDRKILHRDIKAQNIFLSKNG     71 - 140
MVAKLGDFGIARVLNNSMELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLKHPFEGNNLQ    141 - 210
QLVLKICQAHFAPISPGFSRELHSLISQLFQVSPRDRPSINSILKRPFLENLIPKYLTPEVIQEEFSHML    211 - 280
ICRAGAPASRHAGKVVQKCKIQKVRFQGKCPPRSRISVPIKRNAILHRNEWRPPAGAQKARSIKMIERPK    281 - 350
IAAVCGHYDYYYAQLDMLRRRAHKPSYHPIPQENTGVEDYGQETRHGPSPSQWPAEYLQRKFEAQQYKLK    351 - 420
VEKQLGLRPSSAEPNYNQRQELRSNGEEPRFQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGR    421 - 490
EPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQMEFRSCCPGWSAMARSWLTATSASQDIEKDLKQMRL    491 - 560
QNTKESKNPEQKYKAKKGVKFEINLDKCISDENILQEEEAMDIPNETLTFEDGMKFKEYECVKEHGDYTD    561 - 630
KAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEGKTKDP    631 - 700
YSPVLILM                                                                  701 - 708
//

Text Mined References (7)

PMID Year Title