Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.94
PubTator Score 2.00

Knowledge Summary

Patent (529)

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma 5.000 0.000
osteosarcoma -2.314 0.000
medulloblastoma, large-cell -1.100 0.002
atypical teratoid/rhabdoid tumor 1.600 0.002
nasopharyngeal carcinoma -2.100 0.001
lung carcinoma -1.600 0.000
ovarian cancer -3.200 0.000
Breast cancer -1.200 0.000
pituitary cancer -1.100 0.001
chronic rhinosinusitis -2.626 0.011

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
25963817 Nek5 is required for the loss of centrosome linker proteins and enhanced microtubule nucleation that lead to timely centrosome separation and bipolar spindle formation in mitosis
25725288 The hNek5 is mitochondrial localization and its role on cell death and cell respiration defects through COX11, MTX2 and BCLAF1.

AA Sequence

MDKYDVIKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIQEKEASKKEVILLEKMKHPNIVAFFNSF      1 - 70
QENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIHDRKILHRDIKAQNIFLSKNG     71 - 140
MVAKLGDFGIARVLNNSMELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLKHPFEGNNLQ    141 - 210
QLVLKICQAHFAPISPGFSRELHSLISQLFQVSPRDRPSINSILKRPFLENLIPKYLTPEVIQEEFSHML    211 - 280
ICRAGAPASRHAGKVVQKCKIQKVRFQGKCPPRSRISVPIKRNAILHRNEWRPPAGAQKARSIKMIERPK    281 - 350
IAAVCGHYDYYYAQLDMLRRRAHKPSYHPIPQENTGVEDYGQETRHGPSPSQWPAEYLQRKFEAQQYKLK    351 - 420
VEKQLGLRPSSAEPNYNQRQELRSNGEEPRFQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGR    421 - 490
EPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQMEFRSCCPGWSAMARSWLTATSASQDIEKDLKQMRL    491 - 560
QNTKESKNPEQKYKAKKGVKFEINLDKCISDENILQEEEAMDIPNETLTFEDGMKFKEYECVKEHGDYTD    561 - 630
KAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEGKTKDP    631 - 700
YSPVLILM                                                                  701 - 708
//

Text Mined References (7)

PMID Year Title
25963817 2015 Nek5 promotes centrosome integrity in interphase and loss of centrosome cohesion in mitosis.
25725288 2015 Nek5 interacts with mitochondrial proteins and interferes negatively in mitochondrial mediated cell death and respiration.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9552363 1995 The NIMA kinase: a mitotic regulator in Aspergillus nidulans and vertebrate cells.